KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_479696Help
Entry
ARALYDRAFT_479696 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_479696
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ARALYDRAFT_479696
Enzymes [BR:aly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ARALYDRAFT_479696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 576 aa AA seqDB search
MAASFSVPSMIMEEEGRFEAEVAEVQTWWASERFKLTRRPYTARDVVALRGHLKQGYASN
EMAKKLWRTLKSHQANGTASRTFGALDPVQVTMMAKHLDTIYVSGWQCSSTHTSTNEPGP
DLADYPYDTVPNKVEHLFFAQQYHDRKQREARMSMSREERTKTPFVDYLKPIIADGDTGF
GGTTATVKLCKLFVERGAAGVHIEDQSSVTKKCGHMAGKVLVAVSEHINRLVAARLQFDV
MGTETVLVARTDAVAATLIQSNIDARDHQFILGVTNPSLRGKSLSSLLAEGMTVGKNGPA
LQSIEDQWLTSAGLMTFSEAVVQAIKRMNLNENEKNQRLNEWLTHARYENCLSNEQGREL
AAKLGVTDLFWDWDLPRTREGFYRFQGSVAAAVVRGWAFAQIADIIWMETASPDLNECTQ
FSEGIKSKTPEVMLAYNLSPSFNWDASGMTDQQMVEFIPRIARLGYCWQFITLAGFHADA
LVVDTFAKDYARRGMLAYVERIQREERTHGVDTLAHQKWSGANYYDRYLKTVQGGISSTA
AMGKGVTEEQFKESWTRPGADGMGEGTSLVVAKSRM
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatctttctctgtcccctctatgataatggaagaagaagggagattcgaggcg
gaggttgcggaagtgcagacttggtgggcctcagagaggttcaagctaacaaggcgtcct
tacactgcccgtgacgtggtggctctacgtggccatctcaagcaaggctacgcttcgaac
gagatggctaagaagctgtggcgaacgctcaaaagtcaccaagccaacggcacggcctct
cgcacgtttggtgcgttggaccctgttcaggtgaccatgatggctaaacatttggacacc
atctacgtctctggttggcagtgctcgtcaactcacacctccactaacgagcctggtcct
gatcttgctgactatccatacgacaccgttcctaacaaggttgaacacttattcttcgct
cagcagtaccatgacagaaagcagagggaagcaagaatgagcatgagcagagaagagagg
acaaaaactccgttcgtggactacctgaagcccatcatagccgacggagacactggtttt
ggcggcaccaccgccaccgtcaaactttgcaagctcttcgttgagagaggtgccgctgga
gtccacatcgaggaccagtcctcagtcacaaagaagtgtggtcacatggccggaaaagtc
cttgtggcagtcagcgaacacatcaaccgccttgtggcggcgcggctccagttcgacgtg
atgggtacagagaccgtcctggtcgctagaacggacgcggtcgcagctactctgatccag
tcgaacattgacgcgagggaccaccagttcatcctcggtgtcactaacccgagccttaga
ggcaagagtttgtcctcgcttctcgccgagggaatgacggtaggcaagaacggtccggca
ttgcaatccattgaggatcaatggcttacctcggccggtcttatgactttctcggaagct
gtcgttcaggccatcaagcgcatgaacctcaacgagaatgagaagaatcagagactgaac
gagtggctaacccatgcaaggtatgagaactgtctgtcaaatgagcaaggccgagaatta
gcagcaaaactcggggtgacggatctcttctgggactgggacttaccaagaaccagagaa
ggattctaccggttccaaggctcggtcgcagcggccgtggtccgtggctgggcctttgca
caaatcgcagacatcatctggatggaaaccgcaagccctgatctcaatgaatgcacccag
ttctcagaaggtatcaagtccaagacaccggaggtcatgctcgcctacaatctctcgccg
tctttcaactgggacgcttccggtatgacggatcagcagatggtggagttcattccgcgg
attgctaggctcggatattgttggcagttcataacgcttgcgggtttccatgcggacgct
cttgtggttgatacatttgcaaaggattacgcgagacgagggatgttggcttatgtggag
aggatacagagagaagagaggacccatggggttgacactttggctcatcaaaaatggtca
ggtgctaattactatgatcgttatcttaagaccgtccaaggtggaatctcctccactgca
gcaatgggcaaaggtgtcactgaagaacagttcaaggagagttggacaaggccgggagct
gatggaatgggcgaagggactagccttgtggtcgccaagtccagaatgtaa

DBGET integrated database retrieval system