KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_479818Help
Entry
ARALYDRAFT_479818 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K10886  
DNA-repair protein XRCC4
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    ARALYDRAFT_479818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 248 aa AA seqDB search
MVESEKTKHTCLRLEISGADPIFVKGTWHNSHFDISVTDGSSSWICNATEEEVAERAAQW
DQPVSEYLELAERYLGFQQPNSVYGFSDALEGSKRLSWTFEKEGTKLEWRWKCKPSHDSK
KITVGILDFLLEANIRLSEEVVNKTRSFEKMKCEAERCLAQGEKLCEEKTEFENATYAKF
LSVLNAKKAKLRALRDKGDSVRAVEEEESTDKTESFDSGRSDNEQSEEEASKKASSSKAR
GRKRAVRS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggttgaatcggagaaaacgaaacacacatgtctccgtctcgaaatctccggcgccgat
ccaattttcgtcaaaggaacttggcataactctcatttcgatatctccgtcaccgatggc
tcctcctcttggatttgcaatgcgacggaggaggaagtggcggagagagcagcacaatgg
gatcagccagtatcggagtatttagagctcgctgaacgttacttagggtttcaacagcca
aattcggtctatggattctctgatgctcttgagggatctaaacggctctcttggacgttt
gagaaggaagggactaaacttgagtggaggtggaagtgtaagccatcacatgatagtaag
aagatcactgttgggatcttggattttcttttggaggctaatataaggctaagtgaagaa
gttgtgaacaagacgagatcttttgagaagatgaaatgtgaagctgagagatgtctcgca
caaggtgaaaaactctgcgaagaaaaaacagagtttgagaatgcaacttatgcaaagttc
ctttctgtgttaaatgcaaagaaggcaaaactgagagcactaagggacaaaggagattca
gtgagagcagttgaggaggaagaatcgacagacaaaactgaaagctttgacagtggaaga
agtgacaatgagcagagcgaggaagaagcctcaaagaaggcatcaagcagcaaagcccgt
ggccgaaagagagctgtacgcagctaa

DBGET integrated database retrieval system