KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_479940Help
Entry
ARALYDRAFT_479940 CDS       T01578                                 

Gene name
BMY7
Definition
beta-amylase 7
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ARALYDRAFT_479940 (BMY7)
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     ARALYDRAFT_479940 (BMY7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 572 aa AA seqDB search
MALNLSHQLGVLAGTPIKSGEMTDSSLSISPPSARMMTPKAMNRNYKAHGTDPSPPMSPI
LGGTRADLSVACKAFAVENGVETIEEQRTYKEGGIGGEGGGGVPVFVMMPLDSVTMGNTV
NRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGSYNWGGYNELLEMAKKLGLKVQAV
MSFHQCGGNVGDSVTIPLPQWVIEEVDKDPDLAYTDQWGRRNCEYISLGADTLPVLKGRT
PVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCY
DKYSLSSLKAAAEAYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNTEYGDFFLSWY
SQMLLDHGERILSSAKSIFENTGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYL
PIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVALATLAAEVPLAGENALPRY
DDYAHEQILKASVLNLDQNNQGEPREMCAFTYLRMNPELFQADNWGKFVAFVKKMVEGRD
SHRCWEEVERETEHFVHVTQPLVQEVAVALTH
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttaatttatcgcatcagctcggagtactcgccggaactccgatcaaatccggt
gaaatgaccgattcatcgttatcaatttcaccaccatcagcgaggatgatgacacctaaa
gcaatgaatcgaaactacaaagctcatggaacagatccatcaccaccgatgagtccaatt
ttaggggggacgcgtgcggatctgtcggtggcgtgtaaggctttcgcggtggagaatgga
gtcgaaaccattgaagaacagagaacgtataaagaaggagggattggtggagaaggagga
ggaggtgttcctgtgtttgtgatgatgccgcttgatagtgttacgatggggaacacggtg
aatcggagaaaggcgatgaaagcgagtttgcaagcgttgaagagtgctggtgttgaaggg
attatgattgatgtatggtggggtttggtggagaaggaatctccgggaagttataattgg
ggaggttataatgaattgcttgagatggctaagaagcttggacttaaggttcaagctgtg
atgtcgtttcatcagtgtggtggtaacgttggtgattctgtcactattcctctgcctcag
tgggttattgaagaggttgacaaggacccagaccttgcgtacactgatcagtggggaaga
aggaactgtgagtatatatcacttggcgctgatacactcccggttctcaaaggtagaact
cccgtgcaatgctacgcggatttcatgcgtgctttcagagacaacttcaagcatcttctt
ggagagaccattgtggaaatccaagtgggaatgggacctgcaggagaactgcgttaccct
tcgtaccccgagcaagaggggacatggaagttcccagggattggagccttccagtgctat
gataagtactcattaagcagcttgaaagcagcagctgaggcttatgggaagccagaatgg
ggcagtactggcccaaccgatgccggtcactacaataactggccagaagacactcagttc
ttcaaaaaagaaggtggtggttggaacacggagtatggagatttcttcctctcatggtac
tcccagatgctgttagatcacggcgagcggatcctatcctcagccaagtcaatattcgaa
aacaccggtgtcaaaatatcggtcaaaatcgctggaatccactggcactatgggacccgt
tctcacgctcctgagctcacagcaggatactacaacacaaggttcagagatgggtacctc
ccaatagcccaaatgttagccagacacaacgccatattcaacttcacatgtatcgagatg
agagaccacgagcaacctcaagacgcactttgtgcaccagagaagctagttaaccaggtg
gctctagccacgctggctgcagaagttcctctagctggtgaaaacgcattgcctaggtac
gacgactacgcgcacgagcagattctcaaggcctccgtgctgaaccttgatcaaaacaac
cagggagaaccccgagagatgtgtgcatttacttacctaaggatgaacccggagttgttt
caagcagataactgggggaaattcgtagcgtttgtgaagaaaatggttgaagggagagac
tcccataggtgttgggaagaagttgagcgtgagactgagcattttgtgcacgttactcag
ccgctggttcaagaagttgcagtggctctcactcactag

DBGET integrated database retrieval system