KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_480465Help
Entry
ARALYDRAFT_480465 CDS       T01578                                 

Definition
hypothetical protein
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1093 aa AA seqDB search
MGCAYSKTCIGQICATKENSIRQTHQQAPERGGTKAAITAAAGAGAEEENPVFNFSSDAV
DDEDDDEIHQLGLSRDQEWGITRLSRVSSQFLPPDGSRVVKVPSCNYELRCSFLSQRGYY
PDALDKANQDSFAIHTPFGSNSDDHFFGVFDGHGEFGAQCSQFVKRRLCENLLRHGRFRV
DPAEACNSAFLATNSQLHADLVDDSMSGTTAITVMVRGRTIYVANAGDSRAVLAEKRDGD
LIAVDLSIDQTPFRPDELERVKLCGARVLTLDQIEGLKNPDVQCWGTEEDDDGDPPRLWV
PNGMYPGTAFTRSIGDSIAETIGVVANPEIAVVELTPDNPFFVVASDGVFEFISSQTVVD
MVAKHKDPRDACAAIVAESYRLWLQYETRTDDITIIVVHIDGLRDVRKASGTQLQPPIPQ
VVELTGSESPSTFGWNSKNQRVRHDLSRARIRAIENSLENGHAWVPPSPAHRKTWEEEAH
IERVLRDHFLFRKLTDSQCQVLLDCMQRFEANPGDIVVKQGGEGDCFYVVGSGEFEVLAT
QDEKNGEVPRILQRYTAEKQSSFGELALMHNKPLQASVRAVDHGTLWALKREDFRGILMS
EFSNLASLKLLRSVDLLSRLTILQLSHVAESLSEACFSDGQTIVTKDEKLQGLYVIQKGR
VKISFGTEVLESQNVSSLTTGITKEYDNLEIGTEVSIEKHEGSYFGEWALLGELKDSLSV
VAVGEVVCVVLTKENFESAVGPLTNISDDGHKTRHSSFELSKESAKVTDTTSLAKATLAD
LEWTTCLSSTDCSEIGLVHLKDKENLLSLKRFSKQKVKKLGKEAQVLKERNLMKNVIKPS
AFVPEILCTCVDQTFAAILLNTTLACPISSLLHSPLDESSARFITASLVSALEDIHKNEI
LFRGSSPELLMLDQSGYLQIVDFRFAKKLSGERTFTICGNADYLAPEIVQGKGHGYAADW
WALGVLIYYMLEGEMPFGSWRESELDTFQKIAKGQLTFPRGLSSEAEDLITKLLEVDENL
RFGSQGGPESIKKHPWFNGLKWEAISNREFQVPQEIISRIHHHLENDNVFPLETSQSLDS
TDVQDAQNWLEEW
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtgcttattccaaaacttgcattggtcagatttgtgcgacgaaagagaatagt
atcaggcaaacgcatcaacaagctccggagagaggcggtactaaagctgcgattactgcg
gcggcgggggcgggggctgaggaggagaatccggtgtttaatttctcttcagatgcggtg
gatgatgaagatgacgacgaaattcatcagcttggtttgagtagagaccaggaatgggga
attactcggctttctagggtttcttctcaatttctaccaccagatgggtcaagggttgtc
aaggttccgtcttgtaactatgaattgagatgttcgtttctttctcaaagagggtattat
cctgatgctttagataaggctaatcaagatagtttcgctattcatacgccttttgggagt
aattcggatgatcatttctttggggtttttgatggtcatggtgagtttggtgctcagtgt
tcgcagtttgtcaagcggaggttgtgtgagaatcttcttagacatggtaggtttcgtgta
gatcctgctgaggcttgtaattcggcgttccttgccacgaattctcagttacatgctgat
ttggtggatgatagtatgagtgggacaactgcgattacggttatggttagaggaaggacg
atatatgtggcgaatgcaggtgattcaagggcggttttagctgagaagagggatggtgat
cttatagctgttgatttgtctattgatcagactccttttagacctgatgagcttgaaagg
gttaagctttgtggagctagagttcttactcttgatcagattgaaggcttgaaaaatcct
gatgttcagtgttggggtactgaggaagatgatgatggagaccctccgagactttgggtg
cccaatggaatgtatcctggaactgcttttaccaggagtattggtgattctattgcagag
acaattggtgttgttgctaaccctgagattgctgttgttgagctcacaccggataatcct
ttctttgtggttgctagtgatggtgtatttgagttcatctctagtcaaacggtggttgac
atggttgcaaaacataaggatcctcgagatgcttgtgctgcaattgttgctgaatcatat
aggctatggctacagtatgaaactcggacagatgatataacaatcatcgtcgtgcacatt
gatgggctaagagatgtaaggaaagcttctggaactcaattgcagcctcctattccacaa
gttgtggagcttacaggttcggaatctccttccacctttggatggaactctaaaaatcaa
cgtgtgaggcatgatctatctcgagctaggatacgtgccatcgagaattcactagagaat
ggacatgcttgggttcctccatctccagcccacagaaaaacctgggaagaagaagcacac
attgagcgggtgttgcgtgaccatttcctcttcaggaaactcactgattctcagtgccag
gttttgttggattgcatgcaaaggtttgaagctaatccaggagatattgttgtgaaacag
ggtggtgaaggggactgcttctacgttgtgggtagtggagaatttgaggtcttggcaacc
caggatgaaaagaacggtgaggtgcctaggatcttgcagcgttatacagctgagaaacaa
tcatcattcggtgaactcgccttaatgcataacaagccgcttcaggcttctgtacgtgct
gtggatcacggaacattgtgggccttaaaaagagaagattttcgaggaattctgatgtct
gagttttcaaacttagcatccttgaagcttcttcgttctgtcgatcttctttcccgtctt
acaattttgcaactaagccatgttgcagagtctctttccgaagcttgcttttctgatgga
caaacaattgttaccaaggacgaaaaacttcagggcctgtatgttatccagaagggacgc
gtgaaaatatctttcggtacagaggtgttggagagtcaaaatgtttcaagccttacaact
ggaatcactaaagaatatgacaatcttgaaatcggaacagaagtctccatagaaaagcat
gaaggaagttactttggtgaatgggctcttcttggcgaactcaaagattccttaagtgtg
gtcgcagttggcgaagtggtttgtgtggttttaactaaagaaaatttcgagtcagcggtc
ggccctctgaccaatatttcagatgacggtcacaagacaagacattcttcgttcgagctg
tcaaaggaatctgcaaaagttaccgataccacatctcttgctaaagccacccttgcagac
ctggaatggacaacatgcttgagttcaacagactgtagtgagattgggctcgtgcatttg
aaagataaagaaaatttgctcagcttgaaaagattttcgaagcaaaaggtgaaaaagtta
ggtaaagaggcacaagtcttaaaagagcggaatctgatgaagaacgtaataaagccctca
gcttttgttcccgaaatcttgtgcacttgtgtcgatcaaacatttgcagcaatcttactg
aacactactcttgcttgtcctatatcttctctgcttcactctccgcttgatgagtcatct
gcccgtttcattactgcctcacttgtgtctgctctagaagatatacacaagaacgaaatt
ctcttcagaggttcatcccccgagctactgatgttggatcaatccggatatctacagatt
gtagacttcagattcgccaagaaactgtccggggaacgaacatttacaatctgtggaaat
gcagattatttagccccggaaattgttcaaggcaaaggccatggttatgcagctgactgg
tgggctcttggagttttgatctactatatgctagaaggagaaatgccatttgggtcatgg
agagaaagcgagctcgacacgtttcagaagattgcaaaaggccaactaacttttcctcga
ggtctaagttcagaagctgaagatctcatcacaaagttgcttgaagttgatgaaaacctg
cggtttggtagccaaggaggtcctgaatcaatcaagaaacatccctggttcaatggactt
aaatgggaagctattagtaaccgcgaatttcaagttcctcaagagataatctcgcgaatt
catcaccatttggagaatgacaatgttttccctctagaaacttcccaatcgcttgactca
acagatgttcaagatgctcaaaattggcttgaagaatggtaa

DBGET integrated database retrieval system