KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_480493Help
Entry
ARALYDRAFT_480493 CDS       T01578                                 

Definition
PFN1/PRF1
Orthology
K05759  
profilin
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 131 aa AA seqDB search
MSWQSYVDEHLLCDVEGHTLTAAAILGQDGSVWAQSDKFPQLKPQEIDGIKKDFEEPGFL
APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGIYDEPMTGGQCNLVVE
RLGDYLIESEL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaatcatacgtcgatgagcaccttttgtgtgatgtcgaaggccacacgctc
accgccgccgcaattctcggtcaggacggcagtgtctgggctcagagcgacaaatttcct
cagttgaagcctcaagaaatcgatggaatcaagaaggactttgaggagcccgggtttctt
gccccaaccggactatttcttggtggcgaaaaatacatggttatccaaggtgaacaagga
gctgtgatccgagggaagaagggaccgggaggcgtcactatcaagaagacaaaccaagct
cttgtctttggcatctatgatgaaccaatgactggaggtcaatgcaacttggttgtcgaa
aggctcggggattacctcatcgagtctgaactctaa

DBGET integrated database retrieval system