KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_481323Help
Entry
ARALYDRAFT_481323 CDS       T01578                                 

Definition
ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 650 aa AA seqDB search
MHEVGLFVDLNFFTQLILTLFFLSIGLLYFVKRTAAKYFEVGGGSGGFDRDHRRDFMVPD
TVECSVCGKTSTKKCSRCKSVRYCSADCQTSDWKSGHKLKCKVFRSTDSSPVGRDDIDYK
ASLFGNMSASKKSKVALVPQLSQSKAGIKPTDVLFPYESLVRYYNWDRPIMAPCGLTNCG
NSCFANVVLQCLSWTRPLVAYLLERGHKRECRRNDWCFFCEFENHLDRANHSRFPFSPMN
IISRLPNIGGNLGYGRQEDAHELMRSAIDMMQSVCLDEFGGEKVVPPRAQETTLIQYIFG
GLLQSQVQCTACSNVSDQYENMMDLTVEIHGDAVSLEECLDQFTAKEWLQGDNLYKCDRC
DDYVKACKRLSIRCAPNILTIALKRFQGGRFGKLNKRISFPETFDLGPYMSSGVEGSDVY
KLYAVIVHLDMLNASFFGHYICYVKDFRGNWYRIDDSEVEKVELEDVLSQRAYMLLYSRV
QPRPSNLRSEEGQDEKKTDTLNTESNQDGSVESSGVGANDTSVSSLCNGIISHSEDPECG
KESSLSSMSASVPVSEEGKEVDARVDTVDSESNPSIDMEHDSGTDHQEEAANGKEDPAAE
NLAVDSSCSDITTLSPSAATVFIPQENEHSDSESKPLEKEHSDTEMIDAQ
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaagttggattatttgtggatctgaatttcttcacgcagcttatcttgacgtta
ttctttctctcaatcggtctcctctactttgttaaaagaacggcagccaagtacttcgag
gtcggtggtggctccggtggtttcgatagagaccatcgccgagatttcatggttcccgac
acggttgaatgttctgtctgtgggaagacttctaccaaaaagtgctctcgttgcaaatct
gtgagatactgctctgcggattgccaaacgtcagattggaagtcaggacataaactaaaa
tgcaaggtgtttcggagtactgactcatcaccggtgggaagagatgatatcgattacaaa
gcttctctgtttgggaatatgtctgcttctaagaagagtaaggttgcattggttcctcaa
ctgagccaaagcaaggctggcatcaagccaacagatgttcttttcccatacgaaagtttg
gttagatattataactgggacagaccaataatggctccttgtggtctcaccaattgtgga
aacagttgtttcgctaatgtggttctacaatgcctttcctggacacgccctcttgttgca
taccttctggagagaggccacaaaagagaatgtaggcgaaatgattggtgcttcttctgt
gaatttgaaaatcatcttgacagagcaaaccatagccggtttcctttttcaccaatgaac
attatttcacggctgccgaatattggtggaaatcttgggtatggaagacaggaggatgct
catgagttgatgaggtcagcaattgatatgatgcaatctgtttgcctcgacgaatttggt
ggagaaaaagtggtgcctcctcgcgcccaagaaacaacactaattcaatatatatttggt
ggtctccttcagtcacaggtccagtgtactgcttgcagtaatgtttctgaccaatatgaa
aatatgatggatttaactgttgagatacatggggatgcggtatcattggaggaatgtctc
gatcagttcacagctaaagagtggcttcagggggataacttatacaaatgtgatagatgt
gatgactatgtgaaggcatgcaagcgcctttcaattcgttgtgctccaaatattcttaca
attgccttaaaaagattccagggtgggagattcggtaaactgaacaaaagaattagtttt
cccgagacatttgatctaggcccttacatgagcagtggagtagaaggatcagatgtatac
aaactctatgctgtgattgtccatttagatatgttgaatgcctcatttttcggccattac
atatgctatgtcaaggacttccgtggaaactggtatagaatagacgattctgaggtggaa
aaggttgaacttgaagatgtcctttctcaacgagcatacatgctcctctacagcagggtt
cagcccagaccatcaaatcttagatccgaagaaggtcaagatgaaaagaaaacagataca
ttgaacacagaatctaaccaagatggctctgttgagagttccggggtgggagcaaatgac
acaagtgtgtcctctctgtgtaacggcatcatctcacattcagaagaccctgaatgcgga
aaagaatcatcattgtcgtcaatgtcagcatccgtaccagtctctgaagaaggaaaggaa
gttgacgcaagggttgatacagtagattctgaatcaaacccttctattgacatggaacat
gattccggaacagatcatcaagaagaagcagcaaatgggaaagaagatccagcggctgaa
aatctggctgttgattcttcttgttcggacattactactctatctccatctgctgctaca
gtattcatacctcaggagaacgaacattcagacagcgagtccaaacccctggagaaagaa
cattcagacaccgagatgatcgatgctcaatga

DBGET integrated database retrieval system