KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_481495Help
Entry
ARALYDRAFT_481495 CDS       T01578                                 

Definition
ARD/ATARD3
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ARALYDRAFT_481495
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     ARALYDRAFT_481495
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     ARALYDRAFT_481495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 199 aa AA seqDB search
MVEAVRDQREEAIQAWYLDDNEEDQKLPHHKDPKEFVSLDKLAELGVLSWRLDADNYETD
EELKKIRESRGYSYMDICEVCPKKLPNYEATVKMFFVEHLHIDEEIRYCLAGSGYFDVRD
LNDVWIRVWVKKGGLIVFPAGIYHRFTVDSDNYMKAMRLFVGGPVWTAYNRPHDHLPARI
AYMDKFVKVIRDRTIDASA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagccgtgagggatcaaagagaagaagcgattcaagcttggtatttggatgac
aatgaagaggatcagaaacttcctcaccacaaggatcctaaggagtttgtatctttggac
aaacttgcagagcttggagtacttagctggagacttgacgctgataactatgaaaccgat
gaggagttgaaaaagatccgcgaatctcgtggttactcctacatggacatttgtgaggtg
tgtccaaaaaagcttccaaactatgaagcaacagtaaagatgttttttgtagaacattta
cacattgatgaagagattcgttactgcctcgcaggaagtggatactttgatgtgagggat
ctcaatgatgtttggattagagtatgggtaaagaagggaggtttgatagtcttccctgct
ggaatatatcatcgcttcaccgtggactcagacaattatatgaaggcaatgcggcttttc
gtgggtggaccagtgtggactgcttacaatcgcccacacgaccatcttcctgcaaggata
gcgtatatggataaattcgtgaaggtgattagggaccgtaccatagacgcttcagcgtag

DBGET integrated database retrieval system