KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_481514Help
Entry
ARALYDRAFT_481514 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aly00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 305 aa AA seqDB search
MALLLSHCSLQPPLSLSKRVFACPALIRNSISPSLSSSSSSVSSSNSIPQVVVTRELGKN
NQIIKALEKHGISSLELPLIQHARGPDFDRLASVLSDKSFDWIIITSPEAGSVFLEAWKT
ASSPKVQIGVVGAGTARVFEEAMQSAEGLLHVAFTPSKATGKVLASELPEKVGKRSSVLY
PASLKAGNVIVEGLSKRGFEVVRLNTYTTVPVQSVDTVLLQQAVSAPVLSVGSPSAVRAW
LNLIQNEEQWSNYVACIGETTASAAKRLGLKNVYYPEQPGLEGWVESIMEALGAHADSSN
SSGRN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcattgctcctttctcactgctctcttcaacctccattatctctaagcaaacgagtt
ttcgcttgtcctgccctaattcgaaattcaatttccccgtctctctcttcatcttcttcc
tccgttagtagctccaattcgattcctcaggtcgtcgttacccgagaattaggcaagaac
aatcaaatcatcaaagctttggagaaacatgggatatcatctttagagcttcccttgatt
caacatgcgcgaggacctgatttcgataggcttgcttctgtattaagtgataagagcttt
gactggatcatcataacatctccagaagcaggttctgtctttctcgaggcctggaagacg
gctagctccccaaaagtgcaaataggtgtcgtaggagcaggaacagccagggtatttgaa
gaggcaatgcaatcggcagaaggattgcttcatgttgcatttacaccatcaaaagcaacg
ggtaaagtcttggcttcggagcttccagagaaagttggcaaaaggtcctctgtcttatac
ccggcttctctaaaagcaggcaatgttattgtggaagggttgtccaaacgtgggtttgaa
gttgtcaggctgaatacatacacaacagttccggtgcagagtgttgatacggtgcttctg
caacaggctgtgtctgctcctgttctttctgtaggttcaccttctgcagttcgggcctgg
ctgaatctgattcaaaacgaggagcaatggagcaattacgttgcctgcattggagagaca
actgcttcagctgcaaaacgtctaggactaaaaaacgtgtactacccagaacaaccagga
cttgaagggtgggtcgagagcatcatggaagctctaggtgctcacgcagattcaagtaac
tctagcggcaggaattga

DBGET integrated database retrieval system