KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_481568Help
Entry
ARALYDRAFT_481568 CDS       T01578                                 

Definition
atcdpmek
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ARALYDRAFT_481568
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ARALYDRAFT_481568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 383 aa AA seqDB search
MATASPPFISTLNFTHSSFKNTSSSSFSPKLLRPLLSFSVKASRKQVEIVFDPDERLNKI
GDDVDKEAPLSRLKLFSPCKFNVFLRITGKREDGFHDLASLFHVISLGDTIKFSLSPSKS
KDCLSTNVQGVPVDGRNLIIKALNLYRKKTGSDRFFWIHLDKKVPTGAGLGGGSSNAATA
LWAANQLNGGLVTEKELQDWSSEIGSDIPFFFSHGAAYCTGRGEIVQDLPPPFPLDLPMV
LIKPREACSTAEVYKRLSLDQTSNINPLTLLKNVTSNGVSQSICVNDLEPPAFSVLPSLK
RLKQRIIASGRGEYDAVFMSGSGSTIVGIGTPDPPQFIYDDEEYKNVFLSEANFMTREAN
EWYKEPASANATTSSSESRMDFQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggcttctcctccatttatctcaactctcaacttcactcactcttctttcaaa
aatacttcttcttcttcattttctccgaagcttcttcgaccccttttgagcttttccgtc
aaagcttccagaaagcaagtagagatagtgtttgatcctgatgagaggcttaataagatt
ggtgatgatgttgacaaagaagctcctttgtctaggcttaagctcttctctccttgcaag
ttcaatgttttcttgaggataaccggaaagcgagaagatgggtttcatgatttagcctca
ttgtttcatgtgattagcttaggagatactattaaattctcattgtcaccatcgaaatcc
aaagattgtctgtctactaacgttcaaggagtccctgttgatgggagaaatctgattata
aaagcacttaacctttacaggaagaaaactggtagtgacagattcttctggattcattta
gacaagaaggtgcctaccggtgctggactcggtggtggaagtagtaatgctgcaactgca
ctttgggcggcaaatcagctcaatggaggtcttgtcactgagaaggaactccaggattgg
tcaagtgaaattgggtcagatattcctttcttcttctcccatggagcagcctattgtacc
gggagaggtgagattgtccaagaccttcctccaccttttcctcttgatcttccgatggta
ctcataaagccccgagaagcatgttccactgctgaagtgtacaaacgtcttagtctagat
cagacgagcaacattaatcccttgacattactaaagaatgtgaccagcaatggtgtatct
caaagcatttgcgtaaacgatttggaaccgccagcgttttcagttcttccttctctaaaa
cgcttgaagcaacggataatagcatctgggcgtggggaatatgatgccgtatttatgtct
gggagtggaagcacaattgtcggtatcggtacaccagatcctccgcaatttatatacgat
gatgaagaatacaagaacgtgttcttgtctgaagcaaactttatgactcgtgaggctaat
gaatggtacaaagaacctgcttctgcaaatgctactacctcatcctctgaatctcgcatg
gatttccaatga

DBGET integrated database retrieval system