KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_481634Help
Entry
ARALYDRAFT_481634 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 501 aa AA seqDB search
MTRFLVQRGSSGSSSNSSRPSSSGTEPQINNTIQVPPVTIDEEITDEKQEEVTVVEKAEC
SDAKNVAVDISEPVDREDDEGLVVSENVHVESEGIDCDSPVSGGSNPDSPPVPAPPPKPS
STVNPGNNRSVLGSFDALRIGPTRRGSGPRSLVSSRSSPTGSHPSSPRSHSENEGYNSSD
EHMPCYVPSHPGSGLEREHQFEAEIRDSKGFEIRRMLEDGNCLFRAVADQVYGDSEAYDL
ARQMCMDYMEQERDHFSQFITEGFTSYLKRKRRDKVYGNNVEIQALAEMYNRPIHIYSYS
TEPINIFQGNYSTDTPPIRLSYHHGNHYNSLVDPHRLTVGAGLGFSSLSGRHVDKEQVKA
AIKAQQEHQIDNALLAEGRFYSDLELTEKEIERAVMDASRAEYLMEWSKPRIGPKESSTS
NAETSSSGARPSGSDSKPEEAVKKEKTVLSSSIEMVLSMGFSYTQAMEAYSIFGDDVDSM
VCYVLETSCGGNNRRKGKATE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactcggtttttggttcaacgaggttcatcaggaagttcttccaactcgagccgccct
tcttcctcgggaacagaaccacagataaacaatactattcaggttcctcctgttactata
gatgaagaaattacggatgagaaacaagaagaggttactgtagttgaaaaagcagagtgt
tctgatgctaagaatgtagctgtggacattagtgaacctgtggatagagaagatgatgaa
ggattggtagtttcagaaaatgttcatgttgaaagtgaaggtatagattgtgattctcca
gttagtggtggcagtaaccctgattcaccacccgtaccagctccaccaccaaaaccttct
tcgactgtcaatcctgggaataacagatcggtcttgggaagttttgacgctttacgaatt
ggaccaacacgaagaggttctgggcctcgctctcttgtttccagtaggagttcgccaact
ggatcgcatccttcttctccaagatcacacagtgagaacgagggctataacagttctgat
gagcatatgccatgctatgtgccctctcatcctggctctggcttggaaagagaacaccag
tttgaagcagagattagagattcgaaaggctttgaaattaggcggatgttggaagatgga
aattgtctttttcgggctgttgcagatcaagtatatggggactcagaggcatatgacttg
gctagacaaatgtgcatggattacatggaacaagagagggatcacttttctcagttcata
accgaaggttttacttcttacttgaaaaggaaaagaagagataaggtctatggaaacaac
gtagagatccaagctttagcagaaatgtataataggccaatccacatttactcatatagc
acagagcctatcaacatatttcaaggaaactacagcacggatacacctcccataagactg
agttaccaccacgggaatcattataattctttggtggatccacatcggttgacagttggt
gccggacttggatttagtagccttagtgggagacatgtggacaaggaacaggtgaaagct
gctataaaggctcagcaagaacatcagattgataatgcgctcttagcagaagggagattt
tactctgaccttgagcttacggaaaaggaaatagagcgggcggtaatggatgcttcccgt
gctgagtatcttatggaatggtctaagccacgaattggtccaaaggaatcatccacctcg
aatgctgagacatcatcttctggagctagaccttcagggagtgattcgaaaccagaggag
gcagtaaaaaaagaaaagactgtgctgagtagcagtatcgagatggtattgtcgatggga
tttagctacacgcaggccatggaagcttatagcatttttggagatgacgttgactctatg
gtctgttatgtactggagacaagctgtggtggcaacaaccgacgcaaaggcaaagccacg
gaatag

DBGET integrated database retrieval system