KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_481858Help
Entry
ARALYDRAFT_481858 CDS       T01578                                 

Definition
type 1 protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:aly03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 319 aa AA seqDB search
MAEKPAQEQEQKRAMEPGVLDDIIRRLVEFRNTRPGSGKQVHLSEGEIRQLCAVSKEIFL
QQPNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLL
LAYKIKYPENFFLLRGNHESASINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALIDD
RILCMHGGISPELTSLDQIRNIARPMDIPDSGLVCDLLWSDPSGDVKGWGMNDRGVSYTF
GADKVAEFLEKNDMDLICRAHQVVEDGYEFFADRQLVTVFSAPNYCGEFDNAGAMMSIDE
SLMCSFQILKPSEKRSPFQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagccggcgcaagagcaggagcaaaagcgagcgatggaaccgggtgttctg
gacgatatcattcgtcgtttggttgagtttcggaacacgagacctggatcggggaaacaa
gttcatctcagtgaaggtgaaattcgtcagctttgtgctgtctccaaagaaatctttctt
caacaacccaatctgcttgaattggaagctcccatcaagatctgcggtgatattcatggg
cagtattcagatctattgaggctgtttgagtatggaggctttcctcccgaagccaattat
ttgttcttaggtgattatgttgaccgtggcaagcaaagcttggaaacaatatgccttctc
ctagcttacaaaatcaagtacccggagaacttcttcttgttgagagggaatcatgaatct
gcatccattaatcgtatttacggtttttatgacgagtgcaaacgcaggttcaatgtcaga
ctctggaaaatattcactgattgctttaactgtcttcctgtggccgccttaattgatgac
agaatactatgtatgcatggtgggatttccccagagttgacaagtttggaccagattaga
aatattgcacgtccaatggatattccagactctggtttggtatgtgatttactgtggtcg
gatcctagtggagacgtcaaaggctggggcatgaacgatcgcggtgtttcatacactttt
ggagctgacaaagtcgcagagtttttggaaaaaaatgacatggaccttatctgtcgtgcc
caccaggttgttgaagatgggtatgagttctttgcagacagacagcttgttacagtattt
tcagctcccaactattgcggggaatttgacaacgctggcgcaatgatgagcattgatgag
agcttaatgtgctcattccaaattctaaaaccgtcagaaaagaggtcgccttttcaatga

DBGET integrated database retrieval system