KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_481877Help
Entry
ARALYDRAFT_481877 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ARALYDRAFT_481877
Peptidases [BR:aly01002]
 Cysteine Peptidases
  Family C86
   ARALYDRAFT_481877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 385 aa AA seqDB search
MAKIYHERQRLQFCLLHSLNNLFQEKDAFTKESLNSIAEKLVDDDPNKETWTPLSFLLKP
HHNTLTGNYDVNVMIKALEGKGKSVVWHDKRCGASLIDLDDADTLMGIVLNVPVKRYGGL
WRSRHWVVVRKINGVWYNLDSDLVVPQLFRDGDEVRGFLDQNLSLGGEVLLYMSCSLISN
IVDHVREKFSEFAPLMSFGTNDLHVSKYKIFSLVIYNQLTNHSLIIALISMMFSHVRNHS
PEPEVSSKVSAIYKATGTKRFNANTRPVTPGKQSSVNGPYGKNPGCTTSCGLRLPRKTEC
TAARLIKHLSCKFVLGLRLVVMRKKKKKKRSPPLKKASSSGISQPSVISVVNDNNHRSDA
IEDCIQFINSSSSFTRSSSDSGRKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatctatcacgaacgacaacgattacaattttgcctcttgcactccctcaac
aatctatttcaggaaaaagacgcattcactaaagaaagcttgaactcaatcgcagagaag
ctcgtggacgatgatccaaacaaagaaacatggacacctctctcattcctcctcaagcct
caccacaatacactcactggtaactacgacgtaaacgtgatgattaaagctcttgaagga
aaaggcaagagtgttgtttggcatgataagcgttgtggagcttctttgattgatcttgat
gatgcagatactttaatgggtattgtgttgaatgttcctgttaagagatatggtggactt
tggagaagtaggcattgggttgtggttagaaaaatcaatggtgtttggtataatttggat
agtgatctcgttgtgccgcagctgtttagagatggtgatgaagttagagggttcttggat
caaaatctgagtttaggtggagaggttttgctttacatgtcttgtagtttaatttccaac
attgttgatcacgttagagaaaagttcagtgaatttgctccacttatgagttttggaact
aatgatcttcatgtctcaaaatacaaaatcttttctttggtcatttacaaccagctaact
aatcattcattgattattgctctgatctcaatgatgttctcacatgtaagaaatcattct
ccagagcctgaagtctcaagtaaggtatctgcaatttataaagctacaggaacaaaacgg
ttcaatgcaaacactagaccagtaactcctggtaagcaatcctcagtcaatggaccatat
ggtaagaatccgggatgcacaacaagctgtggtttgaggctaccgaggaaaacggaatgc
acagcagcaagactgatcaaacatctcagctgtaaattcgttttgggcttacgtctggtg
gtgatgaggaagaagaagaagaagaagagatctccaccattaaagaaggcttcttcttct
ggtatatctcagccttcggtcatctctgtcgttaatgataataatcacagatcagacgca
atagaagactgcatacaattcataaactcctcttcctccttcacaagatcaagttctgac
agtgggcgtaaatcttaa

DBGET integrated database retrieval system