KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_482740Help
Entry
ARALYDRAFT_482740 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Chromosome and associated proteins [BR:aly03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    ARALYDRAFT_482740
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ARALYDRAFT_482740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 9317577
NCBI-ProteinID: XP_002879676
UniProt: D7LJT8
Position
Unknown
AA seq 128 aa AA seqDB search
MAPKAAEKKPAEKKPVGKAPAEKLPKAEKKISKEAGASVETYKIYIFKVLKQVHPDVGIS
GKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGT
KAVTKFTS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaaagcagcggagaagaaaccggcagaaaaaaaaccagtcggaaaagctccg
gcggagaaactcccaaaggcggagaagaaaatcagcaaagaagccggagcaagcgtcgag
acttacaagatctacatcttcaaggttctgaaacaagttcatccagatgttggaatctct
gggaaagctatgggaatcatgaacagtttcatcaatgatatcttcgagaaacttgctcag
gaatcgtcaaagctcgctagatacaataagaagccgacgattacatcgagggagattcaa
actgctgtgagacttgtgttgcctggagaactcgctaagcatgcggtttctgaaggcaca
aaggcggttaccaaattcaccagttag

DBGET integrated database retrieval system