KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_484821Help
Entry
ARALYDRAFT_484821 CDS       T01578                                 

Definition
glycosyl hydrolase family 9 protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ARALYDRAFT_484821
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ARALYDRAFT_484821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 488 aa AA seqDB search
MGNYGDKGRGNVVIRAILLGLYGIISIVCVNGTNINYKDALTKSLIFLEAQRSGKLPPNN
RVPWRGDSALDDGKLVNVDLSGGYYDAGDNVKYGLPMAFTITTLAWSTITYEKELRATGE
LENARAAIRWGTDYFLKCASRKNRLYVQVGDPNADHQCWARPENMKTPRTVLEISDKVPG
TEIAAEAAAAFAASSIVFRHVDHKYARRLLNKAKLLFKLAKSHKGTYDGECPFYCSNSGY
NDELIWAATWLYKATRNDLYLSYLKFEAISAYVAEFSWDLKYAGAQILITKLIFEGAKGL
DLYKQQADSFVCSNLPGSPYHQVFTTPGGMIHLRDGANSQYVTATAFLFSTYADILQKHN
QKISCGSHQFDSTHLMAFAKKQIDYILGHNPQGRSYMVGFGPNPPKQAHHRGASVPMHEA
NAPLSCPLSFVKWYNKNVPNANELTGAILGGPDRQDKFQDLRWTSVYTEPCTYINSIAVG
VLAKLAAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgggtaattatggggataaaggaagaggaaatgttgtgattagggccatattgttgggt
ctctatggaatcataagcattgtttgtgtcaatggtactaacataaactacaaagatgct
ttaaccaaatccctcatcttcttggaggctcaaagatcaggcaaactccctcctaacaat
agggttccatggagaggtgattctgctctcgacgatggcaaactcgtaaatgtggatttg
tcgggagggtactatgacgcaggagacaatgtaaagtatggtcttccaatggcgtttacg
atcacaacgcttgcttggtctaccattacctatgagaaagaactccgagccacgggagag
ctcgaaaacgctcgtgctgctatccgttggggtacagattatttcctcaaatgtgcttct
cgcaagaaccgcctctatgttcaggttggtgatccaaacgcggaccaccagtgctgggcg
agacccgagaacatgaagacgccaaggacggtgttggagataagcgataaagttccagga
accgagatcgctgcggaagccgccgctgcattcgccgcttcctccatcgttttccgccat
gttgaccacaaatatgcacgccggcttctcaacaaagccaaattgcttttcaagctagcc
aaaagccacaagggtacatacgatggagaatgcccgttttattgttctaactccggttac
aatgacgagttgatatgggcggcaacatggctatacaaggcgacaaggaatgatttgtac
cttagctacctcaaattcgaagccataagcgcttacgtcgctgaattcagctgggatctc
aaatacgctggtgcgcagatcctcatcactaagttgatcttcgaaggcgcaaaaggactt
gatctatacaaacaacaagcagatagttttgtatgctctaatcttcccggaagtccttac
caccaagtttttactaccccaggtggtatgattcacttgagggatggagccaacagtcaa
tatgtcaccgccaccgccttcttgttctcaacctacgctgatatactacagaaacacaac
caaaagatctcttgcggtagccaccaattcgattcaacacacctcatggctttcgctaaa
aaacagattgactacatactagggcataacccacaaggaagatcgtacatggttgggttc
ggaccaaacccaccaaagcaagcccatcacagaggagcctcagtgcccatgcatgaagcc
aacgcgccgttaagttgcccattgagcttcgtgaaatggtacaacaagaacgtacctaac
gctaacgagctcaccggagccatcttgggaggacctgaccgtcaagacaagttccaggat
ctccgatggacttccgtgtacacagaaccttgcacttacatcaactctatcgccgttggt
gttctcgccaagctcgctgcggcttag

DBGET integrated database retrieval system