KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_484983Help
Entry
ARALYDRAFT_484983 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 145 aa AA seqDB search
MAPKAEKKPAEKKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSVETYKI
YIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREIQTAVR
LVLPGELAKHAVSEGTKAVTKFTSS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaggcagagaaaaagccggcagagaagaaaccagtggaggagaaatcaaaa
gcagagaaagctccggcggagaagaaaccaaaagccggcaagaaactcccgaaagaagcc
ggcgccggcggagacaagaagaagaagatgaagaagaagagtgttgagacgtacaagatc
tacatcttcaaggttctgaagcaagttcatccagatattggaatctcaagcaaagctatg
ggaatcatgaacagtttcataaacgatatcttcgagaaattggcatcggaatcgtcgaag
cttgctaggtataataagaagccaacgattacttctagggagattcagactgctgttaga
cttgttcttcctggtgagctcgcgaaacacgctgtttctgaaggaactaaggctgtgact
aaatttaccagctcttga

DBGET integrated database retrieval system