KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_485844Help
Entry
ARALYDRAFT_485844 CDS       T01578                                 

Definition
hydrolase, hydrolyzing O-glycosyl compounds
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ARALYDRAFT_485844
  Lipid metabolism
   00600 Sphingolipid metabolism
    ARALYDRAFT_485844
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ARALYDRAFT_485844
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ARALYDRAFT_485844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1107 aa AA seqDB search
MVSLATQMIIPSENGYRVWEDQTLFKWRKRDPHVTLRCHESVQGALRYWYQRNNVDLTVS
RSAVWNDDAVQAALDSAAFWVDGLPFVKSLSGYWKFFLAPKPANVPDKFYDPAFPDSDWN
ALPVPSNWQCHGFDRPIYTNVVYPFPNDPPHVPEDNPTGCYRTYFQIPKEWKDRRILLHF
EAVDSAFFAWINGNPVGYSQDSRLPAEFEISDYCYPWDSGKQNVLAVQVFRWSDGSYLED
QDHWWLSGIHRDVLLLAKPKVFIADYFFKSKLADDFSYADIQVEVKIDNMQESSKHLVLS
NFIIEAAVFDTKNWYNSEGFNCELSPKVAHLKLNPSPSPTLGFHGYLLEGKLDSPNLWSA
EQPNVYILVLTLKDTSGKVLDSESSIVGIRQVSKAFKQLLVNGHPVVIKGVNRHEHHPRV
GKTNIEACMVKDLIMMKEYNINAVRNSHYPQHPRWYELCDLFGMYMIDEANIETHGFDLS
GHLKHPAKEPSWAAAMLDRVVGMVERDKNHTCIISWSLGNEAGYGPNHSAMAGWIREKDP
SRLVHYEGGGSRTSSTDIVCPMYMRVWDIIKIALDQNESRPLILCEYQHAMGNSNGNIDE
YWDAIDNTFGLQGGFIWDWVDQGLLKLGSDGIKRWAYGGDFGDQPNDLNFCLNGLIWPDR
TPHPALHEVKHCYQPIKVSLTDGLIKVANTYFFHTTEELEFSWKIHGDGLELGSGTLSIP
VIKPQNSFEIEWKSGPWFSFWNDSNAGELFLTINAKLLNPTRSLEAGHLLSSTQIPLPAK
RQIIPQAIKKTDTIITCETVGDFIKISQQDSWELMINVRKGAIEGWKIQGVLLMKEDILP
CFWRAPTDNDKGGGDSSYFLRWKAAQLDNVEFLVESCSVKSITDKAVEIEFIYLGSSASV
SSKTDALFKVNVTYLIYGSGDIITNWSVEPNSDLPPLPRVGIEFHIEKTLDRVEWYGKGP
FECYPDRKAAAHVAIYEHNVGDMHVPYIVPGESGGRTDVRWVTFRNKDGVGIYASTYGNS
SPMQMNASYYTTGELNRATHEEDLIKGQNIEVHLDHKHMGLGGDDSWTPCVHDKYLIPPK
PYSFSLRLCPITASTSVLDIYKDQLPC
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atggtttcattagcgacccaaatgattattccttctgaaaatgggtatagagtttgggag
gatcagacccttttcaagtggcgcaagagagatcctcatgtcaccttgcgttgccatgaa
tccgtccaaggggctttgaggtactggtatcagcgcaataacgtggatctcaccgtatca
agatctgctgtttggaatgatgatgctgttcaagctgctcttgatagcgctgctttttgg
gttgatggcttgccctttgttaagtctttatctggttactggaagtttttcttggctcct
aaacctgcaaatgttcctgacaaattttatgatcctgcattccctgattcagactggaac
gctttacccgttccttccaattggcagtgtcatggatttgatcggcctatctataccaat
gtggtgtaccctttcccgaatgacccgcctcatgttcctgaggataatcctactggttgc
tacagaacctacttccagattcccaaagagtggaaggacagaagaatacttcttcacttt
gaagctgtagactccgcattctttgcttggataaatggcaaccctgttgggtacagtcaa
gacagcaggttaccggctgaatttgaaatatctgattattgctatccatgggactcgggg
aaacaaaatgttcttgctgttcaagtctttagatggagtgatggttcataccttgaagac
caagatcattggtggttgtctggtattcatcgagatgtgcttttgttagcaaagcccaag
gtattcattgctgactactttttcaagtcaaaattggcagatgacttttcctacgcagac
atccaggttgaagtgaagatagacaatatgcaggagtcctcaaagcatcttgttctttct
aacttcatcatagaggctgccgtatttgatactaaaaattggtacaactctgaaggattt
aattgtgaactttctcccaaggtggctcatttgaagcttaatccttctccaagcccaact
cttggatttcatggttatttgcttgagggaaaactggattcgccaaatctctggtcagct
gaacaaccaaatgtttacatcctcgttttaactctaaaagatacatctgggaaagtcctt
gattctgaatcaagcattgttggcattcggcaagtttcaaaggccttcaaacagcttctt
gttaatgggcacccagtcgtgataaaaggtgtaaacaggcatgagcaccatccacgtgtt
gggaagaccaatatagaggcctgcatggtcaaggatttaatcatgatgaaagaatataat
atcaatgcggtgcgaaacagtcattatcctcaacatccccgctggtatgaattatgtgat
ttgttcggcatgtacatgatcgatgaagccaatatagagacacacggttttgatctctct
gggcatctgaagcaccctgcgaaagagccaagctgggcagccgctatgctggatcgagta
gttgggatggttgaaagagacaaaaaccatacatgcataatttcttggtcactgggaaat
gaggctggctatgggcctaatcattctgctatggcaggttggattagggaaaaggacccc
tcacggttggtgcactatgaaggtggtggttccagaacaagttctactgatatagtctgc
cctatgtacatgcgggtttgggacatcatcaagattgcacttgatcaaaatgaatcacga
ccgttgatattatgcgagtatcaacatgctatgggtaacagcaacgggaatatagatgag
tactgggatgcaattgacaatacctttggcctgcaaggaggtttcatatgggactgggtt
gaccaggggctattgaaactggggtcagatggcattaagcgttgggcatatggaggggac
tttggtgaccagcctaatgatttgaacttctgtctcaatgggcttatatggcctgaccga
actcctcatccagcactccatgaggttaagcattgctatcaaccaatcaaggtttcattg
acggatggcttgataaaggttgcaaacacttactttttccacacaacagaagaattggag
tttagttggaaaattcatggggacggtcttgaacttggatctggaactctctctattcct
gtgataaagccacaaaatagttttgagatagagtggaagtcaggtccatggttttccttc
tggaatgactcaaatgctggagaattgtttctgacaataaatgccaagcttctaaatcct
actcgttcgcttgaagctggtcatcttttgtcttcaacgcagattcctttaccagcaaag
agacaaataataccgcaggcgataaaaaagacagacactattatcacttgtgaaactgtt
ggagatttcattaagatcagccagcaagattcatgggagctaatgataaatgtccgaaaa
ggagctattgaaggttggaagattcaaggagttctccttatgaaggaagatatactgcca
tgcttttggcgagcacctacagacaatgataaaggtggaggtgactctagttattttttg
agatggaaagcagcacagttggataatgtggagttccttgttgaaagctgttcagtgaag
agcatcactgataaagccgtagagatagagttcatataccttggttcttcagcttctgtc
tcttcaaagacagatgccttattcaaagtcaatgttacatatctgatctatggttccgga
gatatcatcaccaattggtctgtagaaccaaactctgatcttccaccgctaccacgtgta
ggtatagaatttcacattgaaaaaacactggaccgtgtagaatggtatggcaaaggtcca
tttgagtgttacccagaccgaaaagcagcagcccatgtggccatatatgaacacaatgtt
ggagacatgcatgtcccttatattgttccaggagaaagtggtggtagaacagatgttagg
tgggtgacattccgaaacaaagatggtgtaggaatatatgcttcaacatatggtaactct
tccccaatgcagatgaatgctagttactatacaacaggtgagcttaatcgtgcaacgcat
gaagaggatcttatcaaaggacaaaacatcgaggtgcatctggaccacaaacacatgggt
cttgggggagatgatagctggactccatgtgttcacgataagtatctgattccacccaaa
ccatattcattctctctaaggttgtgcccaattactgcatccacttcggtcttggacatc
tacaaggaccaacttccctgctag

DBGET integrated database retrieval system