KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_485913Help
Entry
ARALYDRAFT_485913 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ARALYDRAFT_485913
Enzymes [BR:aly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ARALYDRAFT_485913
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ARALYDRAFT_485913
  Exosomal proteins of colorectal cancer cells
   ARALYDRAFT_485913
  Exosomal proteins of bladder cancer cells
   ARALYDRAFT_485913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 577 aa AA seqDB search
MASSSTSISLLLFVSFLLLLVDSRAENASSGSDLDEELAFLAAEESKEQSHGGGSYHEEH
DQYRDFENYDDLEQGGGEFHHGEHSYEEEPLPTVDEKDVAVLTKDNFTEFVGNNSFAMVE
FYAPWCGACQALAPEYAAAATELKGVAALAKIDATEEGDLAQKYEIQGFPTVFLFVDGEM
RKTYEGERTKDGIVTWLKKKASPSIHNITTKEEAERVLSAEPKLVLGFLNSLVGSESEEL
AAASRLEDDLSFYQTASPDIAKLFELETQVKRPALVLLKKEEEKLARFDGNFTKTAIAEF
VSANKVPLVINFTREGASLIFENAVKNQLILFATANESEKHLPTLREVAKSFKGKFVFVY
VQMDNEDYGEAVSGFFGVTGTAPKVLVYTGNEDMRKFILDGELTVKNIKTLAEDFLADKL
KPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWCGHCQSFEPIYNKLGK
YLRGIDSLVVAKMDGTSNEHPRAKADGFPTILFFPGGNKSFDPITVDVDRTVVELYKFLK
KHASTPFKLEKPATPEPVISTKKADEKIEGDSSKDEL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcatctacaagtatctctctccttctcttcgtctctttccttcttcttctc
gttgactcgcgtgcagagaatgcgtccagtggatcggatctcgacgaggaattggctttc
ctcgccgcggaggaatctaaggaacaaagtcacggcggcggttcgtaccacgaggagcac
gatcagtaccgagacttcgagaattacgatgatctcgagcaaggaggcggcgagtttcat
cacggcgagcacagttacgaggaggagccgttaccaacagtcgacgagaaagacgtggcg
gttttgaccaaggacaatttcaccgagttcgtcggcaacaatagcttcgcgatggtggag
ttttacgctccttggtgcggcgcttgtcaggctttggcgccggagtacgccgccgctgcc
acggagttgaaaggcgttgccgcgctcgccaagatcgacgcgacggaggaaggggatttg
gctcagaagtacgagattcagggcttccccaccgttttcttgtttgtcgacggagaaatg
cgcaagacctacgaaggcgaaaggactaaggatggtattgtgacttggctgaagaagaag
gccagtcctagcatccacaacatcactactaaagaggaggctgagcgtgttttgtccgct
gaacctaaacttgttcttggttttctcaactctttagtggggtcagagagtgaggagctt
gcagctgcatccagactggaagacgatctcagtttttaccaaactgcaagccctgatatt
gcaaagctatttgaactagaaacccaagtcaagcgtcctgccttagttttactgaaaaag
gaggaagagaaacttgcccgttttgatggaaatttcactaaaacggctatagcagagttt
gtgtcagccaacaaagtcccattggtgatcaatttcacaagggaaggtgcatcactgatt
ttcgagaacgctgtgaaaaaccaactcattctttttgccacggcaaatgaatcagagaag
caccttcccactctgagggaggtggcaaagtccttcaagggaaagtttgtttttgtttat
gtgcaaatggacaatgaggattatggagaagcagtttctggattctttggtgttaccggc
actgcccccaaggttcttgtatacactggaaatgaagatatgaggaagtttattctggac
ggtgaattgaccgtaaagaacattaagacacttgcggaagatttcctagcagacaaactg
aagcctttctacaagtcagatccactaccggaaaataacgacggtgatgttaaggtcatt
gtgggaaacaattttgatgagattgttcttgacgagtcaaaggatgttcttctcgagata
tatgctccttggtgtgggcactgccaatcatttgagcctatttacaacaagcttggaaag
tatttaagaggcattgactcgttagttgtagcaaagatggatggtaccagcaatgagcat
cctagagcaaaggctgatgggttcccaacaatcctgttcttccctggtggaaacaagagc
ttcgatccgatcactgtggatgttgaccgtacagtagtggaattgtacaaattcctgaag
aagcacgcatcaaccccatttaaacttgagaaaccggcaacacctgaaccggtgatctcg
accaagaaagctgatgagaagatcgagggtgatagttccaaggatgagttgtga

DBGET integrated database retrieval system