KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_485933Help
Entry
ARALYDRAFT_485933 CDS       T01578                                 

Definition
chalcone--flavonone isomerase
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    ARALYDRAFT_485933
Enzymes [BR:aly01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     ARALYDRAFT_485933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 244 aa AA seqDB search
MSFSSVSPSQFPSVTKLQVDSVTFDPSVKSPASSNPLFLGGAGVRGLDIQGKFVIFTVIG
VYLEGNAVPSLSLKWKGKTTEELTESVPFFREIVTGAFEKFIKVTMKLPLTGQQYSEKVT
ENCVAIWKSLGIYTDCEAKAVEKFLEIFKEETFPPGSSILFVLSPTGSLTVAFSKDDSIP
ETGIAVIENKLLAEAVLESIIGKNGVSPGTRLSIAERLAELMTKNKVEEDASNHSIEEKL
AKEN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctcatccgtctctccgtcgcagttcccctccgtcacgaagctccaggtcgac
tccgtcacgtttgatccgtccgtcaagtcgccggcctcctccaatccattattcctcggc
ggcgccggtgtccgaggccttgatatccaaggaaaattcgttatcttcaccgtcattgga
gtatacctagagggtaacgccgtaccatctctatcccttaagtggaagggcaaaactacg
gaggagctaacggaatctgtcccgttcttccgtgaaatcgtcaccggtgcgtttgagaag
tttatcaaagtgacgatgaaactgccgttaacgggacaacaatattcagagaaagtgacg
gagaattgtgtggccatatggaaatccttagggatttatacggactgtgaagccaaagcg
gtggagaagtttttggagatcttcaaggaagaaacattccctcccggttcatcgatcctc
ttcgttctctcccctaccggctctcttacggttgcgttttctaaagatgatagtatccct
gaaaccgggatcgctgtcatcgagaacaaattgttggcggaggcggttctggagtcaatt
atcgggaagaacggagtgtcgcctgggactaggttgagtattgcagagagattagctgaa
ctgatgacgaagaacaaggttgaagaggacgctagcaatcactctattgaagaaaaacta
gccaaagagaactga

DBGET integrated database retrieval system