KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_485946Help
Entry
ARALYDRAFT_485946 CDS       T01578                                 

Definition
(RefSeq) glycosyl hydrolase family 20 protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00511  Other glycan degradation
aly00520  Amino sugar and nucleotide sugar metabolism
aly00531  Glycosaminoglycan degradation
aly00603  Glycosphingolipid biosynthesis - globo and isoglobo series
aly00604  Glycosphingolipid biosynthesis - ganglio series
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ARALYDRAFT_485946
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    ARALYDRAFT_485946
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    ARALYDRAFT_485946
   00604 Glycosphingolipid biosynthesis - ganglio series
    ARALYDRAFT_485946
   00511 Other glycan degradation
    ARALYDRAFT_485946
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ARALYDRAFT_485946
Chaperones and folding catalysts [BR:aly03110]
 Intramolecular chaperones
  Others
   ARALYDRAFT_485946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 9314097
NCBI-ProteinID: XP_002876291
UniProt: D7LV27
Position
Unknown
AA seq 544 aa AA seqDB search
MSPNLLRLLFLLMIFISLSITSSLSTPSPADSPPYLWPLPAEFSFGNETLSVDPALTLII
AGNGGGSPIVRAAFDRYMGITFKHASGRASLLARIRFLRMVEYDITSLKIVVHSDSEELQ
LGVDESYTLMVSKKNEQSIVGAATIEANTVYGALRGLETFSQLCAFDYLTKSVQIYKAPW
YIQDKPRFGYRGLLIDTSRHFLPMDVIKQIIESMSFAKLNVLHWHIVDEQSFPFETPTYP
NLWKGAYSRWERYTVEDASEIVRFAKMRGINVMAEVDVPGHAESWGTGYPDLWPSLSCRE
PLDVTKNFTFDVISGILADMRKIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKD
AYKYFVLRAQQIAISKNWTPVNWEETFSSFGKDLDPRTVIQNWLVSDICQKAVAKGFRCI
FSNQGYWYLDHLDVPWDEVYNTEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWP
RAAAAAERMWSTREAVSKGNITLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPSGPGS
CYAQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccgaatcttcttcgtcttcttttcctattgatgatattcatctctttatctatc
acttcatctctgtcaactccgtcgccggctgattctcctccttatctatggccgttgccg
gcggagttttcgttcggaaacgagacactctcggtggatccggcattgactctaatcata
gctggaaacggcggtggatctccgattgttagagctgcgtttgataggtatatgggtata
acctttaaacacgcttctggtagagcttctctattggcgagaattagatttctgagaatg
gttgagtatgatatcacttctttgaagatcgttgttcactctgattctgaggagcttcaa
ttgggtgtggatgagagttatacattgatggtgtcgaagaagaacgagcaatcgattgtt
ggagcagccaccatcgaggctaatacagtttatggtgcacttagaggattggagacattt
agccaattgtgtgcctttgattatctaaccaaatctgtgcaaatatataaagcaccctgg
tatattcaagataaacctagattcggataccgcggtctgctaatagatacatcaagacat
tttttgccaatggatgtcattaagcaaataatcgaatccatgtcctttgccaaacttaat
gtcctgcattggcacattgtagacgagcaatcatttccttttgaaactcctacatatcct
aatttgtggaaaggagcttattcgagatgggaacgttacacagttgaagatgcctctgag
attgtcaggtttgccaaaatgagaggtattaatgtcatggctgaagtagatgtccctggc
catgcggaatcgtggggaactggataccctgatctttggccgtctctgtcttgccgagag
ccccttgatgttactaaaaattttacattcgatgtgatttctggcattttggcagatatg
agaaagatatttccatttgagcttttccacttgggtggtgatgaagttaatacagattgc
tggaaaaacacaactcatgttaaagaatggcttcagggtcgcaacttcactactaaggac
gcatataaatactttgtactccgagcgcaacagatagctatatcgaaaaattggacacct
gtcaactgggaagaaaccttcagttcctttggaaaagatcttgatccgcggactgtgatt
caaaactggctagtgtctgatatatgtcaaaaagcagtagcaaaaggattcaggtgcatt
ttcagtaaccaaggatattggtatctcgaccatctagatgtgccgtgggacgaggtttat
aacaccgagcctctaaatggaatcgaggatccttctctccaaaagttggttatcggagga
gaagtttgcatgtggggtgaaacagctgatacatccgttgtccttcagaccatttggccg
cgtgctgcagcagctgcagaacggatgtggagcaccagagaggccgtgtcaaaggggaac
ataacgttaaccgcattgccacgtctacactattttagatgtctactgaataaccgcgga
gttccagcagctccagtcgataacttttacgcaagaagaccgccctcgggacctggttct
tgctatgctcagtga

DBGET integrated database retrieval system