KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_485946Help
Entry
ARALYDRAFT_485946 CDS       T01578                                 

Definition
glycosyl hydrolase family 20 protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ARALYDRAFT_485946
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    ARALYDRAFT_485946
   00603 Glycosphingolipid biosynthesis - globo series
    ARALYDRAFT_485946
   00604 Glycosphingolipid biosynthesis - ganglio series
    ARALYDRAFT_485946
   00511 Other glycan degradation
    ARALYDRAFT_485946
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ARALYDRAFT_485946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 544 aa AA seqDB search
MSPNLLRLLFLLMIFISLSITSSLSTPSPADSPPYLWPLPAEFSFGNETLSVDPALTLII
AGNGGGSPIVRAAFDRYMGITFKHASGRASLLARIRFLRMVEYDITSLKIVVHSDSEELQ
LGVDESYTLMVSKKNEQSIVGAATIEANTVYGALRGLETFSQLCAFDYLTKSVQIYKAPW
YIQDKPRFGYRGLLIDTSRHFLPMDVIKQIIESMSFAKLNVLHWHIVDEQSFPFETPTYP
NLWKGAYSRWERYTVEDASEIVRFAKMRGINVMAEVDVPGHAESWGTGYPDLWPSLSCRE
PLDVTKNFTFDVISGILADMRKIFPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKD
AYKYFVLRAQQIAISKNWTPVNWEETFSSFGKDLDPRTVIQNWLVSDICQKAVAKGFRCI
FSNQGYWYLDHLDVPWDEVYNTEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWP
RAAAAAERMWSTREAVSKGNITLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPSGPGS
CYAQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccgaatcttcttcgtcttcttttcctattgatgatattcatctctttatctatc
acttcatctctgtcaactccgtcgccggctgattctcctccttatctatggccgttgccg
gcggagttttcgttcggaaacgagacactctcggtggatccggcattgactctaatcata
gctggaaacggcggtggatctccgattgttagagctgcgtttgataggtatatgggtata
acctttaaacacgcttctggtagagcttctctattggcgagaattagatttctgagaatg
gttgagtatgatatcacttctttgaagatcgttgttcactctgattctgaggagcttcaa
ttgggtgtggatgagagttatacattgatggtgtcgaagaagaacgagcaatcgattgtt
ggagcagccaccatcgaggctaatacagtttatggtgcacttagaggattggagacattt
agccaattgtgtgcctttgattatctaaccaaatctgtgcaaatatataaagcaccctgg
tatattcaagataaacctagattcggataccgcggtctgctaatagatacatcaagacat
tttttgccaatggatgtcattaagcaaataatcgaatccatgtcctttgccaaacttaat
gtcctgcattggcacattgtagacgagcaatcatttccttttgaaactcctacatatcct
aatttgtggaaaggagcttattcgagatgggaacgttacacagttgaagatgcctctgag
attgtcaggtttgccaaaatgagaggtattaatgtcatggctgaagtagatgtccctggc
catgcggaatcgtggggaactggataccctgatctttggccgtctctgtcttgccgagag
ccccttgatgttactaaaaattttacattcgatgtgatttctggcattttggcagatatg
agaaagatatttccatttgagcttttccacttgggtggtgatgaagttaatacagattgc
tggaaaaacacaactcatgttaaagaatggcttcagggtcgcaacttcactactaaggac
gcatataaatactttgtactccgagcgcaacagatagctatatcgaaaaattggacacct
gtcaactgggaagaaaccttcagttcctttggaaaagatcttgatccgcggactgtgatt
caaaactggctagtgtctgatatatgtcaaaaagcagtagcaaaaggattcaggtgcatt
ttcagtaaccaaggatattggtatctcgaccatctagatgtgccgtgggacgaggtttat
aacaccgagcctctaaatggaatcgaggatccttctctccaaaagttggttatcggagga
gaagtttgcatgtggggtgaaacagctgatacatccgttgtccttcagaccatttggccg
cgtgctgcagcagctgcagaacggatgtggagcaccagagaggccgtgtcaaaggggaac
ataacgttaaccgcattgccacgtctacactattttagatgtctactgaataaccgcgga
gttccagcagctccagtcgataacttttacgcaagaagaccgccctcgggacctggttct
tgctatgctcagtga

DBGET integrated database retrieval system