KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_485989Help
Entry
ARALYDRAFT_485989 CDS       T01578                                 

Gene name
P5CS2
Definition
delta 1-pyrroline-5-carboxylate synthase 2
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aly01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aly00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 726 aa AA seqDB search
MTEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSS
GAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQ
MLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAISTRRAPYKDSTGIFWDNDSLA
ALLSLELKADLLILLSDVEGLYTGPPSDSTSKLIHTFIKEKHQDEITFGEKSKLGRGGMT
AKVKAAVNAAYGGVPVIITSGYAAENISKVLRGLRVGTLFHQDAHLWAPVVDTTSRDMAV
AARESSRKLQALSSEDRKQILLDIANALEANEKTIKAENDLDVAAAQEAGYEESLVARLV
MKPGKISSLAASVRQLAEMEDPIGRVLKKTQVADDLILEKTSSPIGVLLIVFESRPDALV
QIASLAIRSGNGLLLKGGKEARRSNAILHKVITDAIPKTVGGKLIGLVTSREEIPDLLQL
DDVIDLVIPRGSNKLVSQIKNSTKIPVLGHADGICHVYVDKSCKLDMAKRIVSDAKLDYP
AACNAMETLLVHKDLEQNGFLSDLIYVLQTKGVTLYGGPRASAKLNIPETKSFHHEYSSK
ACTVEIVEDVYGAIDHIHQHGSAHTDCIVTEDSEVAEIFLRQVDSAAVFHNASTRFSDGF
RFGLGAEVGISTSRIHARGPVGVEGLLTTRWIMRGKGQVVDGDNGIVYTHKDLPVLQRTE
AVENGI
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacggagatcgatcgttcacgcgcgttcgccaaagacgttaagcgtatcgtcgtcaag
gttgggactgcagttgttactgggaaaggtggaagattggctcttggacgtttaggagca
atctgtgaacagcttgcggaattaaactcggatggatttgaggtcattttggtgtcatct
ggtgccgttggtctcggtcgacagaggcttcgatatagacaactagtcaacagcagtttt
gcagacttacagaagccacaaatggaacttgacgggaaggcttgtgctggtgttggacag
agtagcctcatggcttactatgagactatgtttgaccagttggatgtgacggttgctcaa
atgcttgtgactgatagcagttttagagataaagatttcaggaagcaacttagtgaaaca
gtcaaagcgatgctgaggatgagggttattcctgttttcaatgaaaatgatgctataagc
actcgcagagccccctataaggattctactggtatattttgggataatgacagcttagct
gctcttctgtcgctagagctgaaagctgatcttttgattcttctaagtgatgttgagggt
ctttacactggccctccaagtgattctacctcaaagttaatccacacattcattaaagaa
aaacaccaggacgagattacttttggcgaaaagtccaaattaggacgagggggtatgact
gcaaaagttaaagctgctgttaatgcagcttatggtggcgttcctgttatcataaccagt
gggtatgcagctgagaatataagtaaagtccttagaggactgcgtgttggtaccctgttc
catcaagatgctcatttgtgggcgccggtcgtagataccacttctcgtgacatggcagtt
gctgcaagggaaagctcgagaaagcttcaggccttatcttcagaagataggaaacaaatt
ctactcgacattgccaatgcccttgaagcaaatgagaaaacaattaaagctgagaatgat
ttggatgtcgctgcagcacaagaagctggatatgaagagtctttggtagctcgcttagtt
atgaagcctgggaagatctcaagccttgcggcttccgtacgccagctagctgaaatggaa
gatccaataggccgtgtattaaagaaaactcaggttgcagatgatcttattttagagaag
acctcatcaccaataggtgttcttctgattgtttttgaatcccggcctgatgcacttgtt
caaatagcttcgcttgcaatccggagtggaaatggtcttctcctgaagggtggaaaggag
gctcgtcgatcaaatgctatcttacacaaggtgatcactgatgcaattccgaagactgtt
ggaggtaaactaataggacttgtgacttcgagagaggagattcctgatttgctccagctt
gatgacgttattgatcttgtaatcccaagaggcagcaacaagcttgtttctcagataaaa
aactcgacgaaaatcccagtgctaggccatgctgatggaatctgtcatgtatatgttgat
aagtcttgtaaactggacatggcaaagcgcatcgtttccgacgcaaagttggactatcca
gcagcttgtaatgcgatggaaacccttcttgtacataaagatttggagcagaatggtttt
ctcagtgatcttatttatgttctgcaaaccaaaggcgtcactttgtatggtgggccaaga
gcaagtgcaaaactgaatattccagaaacaaaatcatttcaccacgagtacagttccaag
gcctgcaccgttgaaattgtagaagacgtatatggtgctatagatcatattcaccaacat
ggaagtgcacacactgattgcatagtgacagaagatagtgaagtggcagagatattcctc
cgccaagtggacagtgctgctgttttccacaatgcaagcacaagattctctgacggtttt
cgattcggacttggtgctgaggtgggaataagcacaagcaggattcatgcccgtggtcca
gtcggagttgaaggattattgacaacgagatggataatgagaggaaaaggacaagttgtg
gatggagacaatggaatcgtttacacccataaggatcttcctgtcttacaaaggacagag
gctgttgagaatggaatttag

DBGET integrated database retrieval system