KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_486071Help
Entry
ARALYDRAFT_486071 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ARALYDRAFT_486071
  Lipid metabolism
   00561 Glycerolipid metabolism
    ARALYDRAFT_486071
   00600 Sphingolipid metabolism
    ARALYDRAFT_486071
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    ARALYDRAFT_486071
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ARALYDRAFT_486071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 430 aa AA seqDB search
MKDSVLFLVGLFSLSVLVSQSISGRVKAPLLQSNTGGLVFSKSFNSIYDTSMYGRLQLNN
GLARTPQMGWNSWNFFACNINETVIKETADALLSSGLADLGYIHVNIDDCWSNLLRDSKG
QLVPHPETFPSGIKLLADYVHSKGLKLGIYSDAGVFTCQVRPGSLFHEVDDADIFASWGV
DYLKYDNCFNLGIKPIKRYPPMRDALNATGRSIFYSLCEWGVDDPALWAKEVGNSWRTTD
DINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGMTYEEYRGHFSIWALMKAPL
LIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKIQANGEDDCQQVWSGPLSGDRIVV
ALWNRCSEQATITASWDVIGLESTISVSVRDLWQHKDVTENASGSFEAQVDAHDCHMYVL
TPQTVSHSDV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcagtattgttcctcgttgggctcttctctttatctgttttggtctctcag
tcgatctcagggagagtcaaagctccattgttgcagagcaatactggtggattagttttc
agcaaatccttcaattcgatctatgatacttctatgtacggacgcttgcagctcaacaat
ggccttgctcgaactcctcaaatgggatggaatagctggaatttctttgcttgcaatatc
aatgaaacagtcataaaggaaactgctgatgctttactttcatctggattggctgatttg
ggatacatacatgtcaatattgatgattgttggtccaatttgttacgcgattcaaagggt
caattggttcctcatcctgaaaccttcccatcaggaattaagcttcttgctgattatgtt
cattcaaagggtctcaaactcggtatatattctgatgctggcgttttcacgtgtcaagtt
cgcccgggatcccttttccatgaagtggatgatgctgacatatttgcttcttggggtgtg
gattatctgaaatatgacaactgtttcaacctgggaataaaaccaatcaaaagataccct
ccaatgcgtgatgctctaaacgcaactggtcgctcaatcttctattcactttgtgaatgg
ggcgttgatgatccagccttgtgggcaaaagaagttggaaacagttggcgcacaaccgat
gacatcaacgatacatgggcaagtatgactacaattgctgatttgaataacaagtgggct
gcatatgctggacctggtggttggaatgatccggatatgttggaaattgggaatggaggg
atgacatacgaggagtatcgaggtcattttagcatttgggctttgatgaaggcacccctg
ttgattggttgtgatgtaagaaacatgaccgctgaaacttttgagattttgagtaataag
gaagttatcgctgtaaaccaagacccacttggtgttcaaggaaggaaaattcaagccaat
ggagaagatgattgtcagcaggtgtggtcaggacctttatctggtgaccgtattgtagtt
gctctctggaaccgttgctctgagcaagcaaccattacagcatcatgggatgtgattggt
cttgaatctaccattagcgtctcagtaagagatttgtggcagcacaaagatgttacagag
aacgcgtctggctcctttgaagctcaagtagacgcacacgactgtcatatgtacgttctc
actccccagacagtatcacactccgatgtatag

DBGET integrated database retrieval system