KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_486203Help
Entry
ARALYDRAFT_486203 CDS       T01578                                 

Gene name
AGK2
Definition
guanylate kinase-encoding gene 1
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ARALYDRAFT_486203 (AGK2)
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ARALYDRAFT_486203 (AGK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 390 aa AA seqDB search
MGEAPAFFVDHLENGYTNGFGVKSEPKNRDTSVQIGDRSFVIGGNHEGNPLFLGVQIHDK
ITNKCSSPTVLGTGPKPCKGYSAIVLPKGRILVIKKGSASDDSIWFLEVDTPFIREQKKL
LGREVVAWSKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRAPRCME
KNGVHYHFTDKTVMEKEIKDGKFLEFASVHGNLYGTSIESVEVVTDSGKRCILDIDVQGA
RSVKASSLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNAEAEIKAGKSSGIFEH
ILYNDNLEECYKNLKNLLGINDLAPVNGVEAVEGIDLPKEHTVTKMDDKILIQETGEGTK
NKMIVLDLSSINGGAPGRTRGIVLDTVKSS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagcaccagctttctttgtggatcatctggagaatggatacaccaatggcttt
ggtgtcaaatccgagcctaagaacagagatacgtctgtccaaattggggatcgatccttt
gtgattggtggaaatcatgaaggaaacccattgttccttggtgttcagattcatgacaaa
atcactaacaagtgctctagtcctactgttcttgggacaggccctaaaccctgcaagggt
tactctgccattgttcttccaaaaggtcggattttggttatcaaaaaaggctcagcttct
gatgactccatttggttccttgaggtggatactccttttatccgggaacaaaagaaattg
cttggaagagaggttgttgcttggagtaaaggagtaaggggaaatgctgagaagcctatt
gttataagcggtccttctggagttggaaaaggaacacttatatcgatgcttatgaaggag
tttccttcaatgtttgggttctctgtgagccatacaactcgagctccaaggtgtatggag
aagaatggtgttcactaccatttcactgataagactgttatggagaaagaaatcaaagac
gggaagtttctcgagtttgcatctgttcatggtaatctatacggaaccagcattgaatcc
gttgaggttgtaaccgattcaggaaagagatgcattttggacattgatgttcaaggagcg
aggtcagtgaaggcgagttcactggatgcgatattcatatttgtctgtcctccttcaatg
aaggaacttgaagatcgacttcgtgctcgaggaaccgagacagaggagcagatccaaaag
cggcttagaaacgctgaagcagagatcaaagcggggaaatcctctggcatttttgaacac
attctgtataatgacaaccttgaggaatgctacaagaaccttaagaatctcttggggata
aacgaccttgctcctgtgaatggtgtagaagcagtagaagggatcgatctgcccaaggag
cacacagtaacaaagatggatgacaagattttgattcaagaaacaggagaaggaaccaaa
aacaaaatgatcgtgttggatctatcttcaattaacgggggagcaccgggaagaacaaga
gggatcgttctggacacggttaagtccagttga

DBGET integrated database retrieval system