KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_486525Help
Entry
ARALYDRAFT_486525 CDS       T01578                                 

Definition
enoyl-CoA hydratase/isomerase family protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aly01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aly00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:aly00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:aly00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 401 aa AA seqDB search
MHNANGLLGRIVRDKLWRFGYRRSFCSLKVTPEDLDYQVLVEGSGCSRTAILNRPPALNA
LTTHMGYRLQKLYKNWEEDPNIGFVMMKGSGRAFCAGGDIVSLYHLRKRGSPDAIREFFS
SLYSFIYLLGTYLKPHVAILNGVTMGGGTGVSIPGTFRVATDRTIFATPETIIGFHPDAG
ASFNLSHLPGRLGEYLGLTGLKLSGAEMLACGLATHYIRSEEIPVMEEQLKKLLTDDPSV
VESSLEKCAEVAHPEKTGVIRRIDLLEKCFSHDTVEEIIDSLEIEAGRRKDTWCITTLRR
LKESSPLSLKVALRSIREGRLQTLDQCLIREYRMSLQGLIGPMSGNFCEGVRARLIDKDE
APKWDPPSLEKVSEDMVDNYFSALTPTEPDLELPVKLRESI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcataacgcgaatgggttgttgggacgaatcgttcgagataagctatggagatttggg
tatcggaggagcttttgctcgcttaaagtcactcccgaggatcttgattaccaggtactc
gttgaaggaagtggttgttcccgtactgcgattctcaatagaccacctgctctcaatgcg
ctcaccactcacatgggatataggttgcagaagctttataagaattgggaagaagatcca
aatatcgggtttgtgatgatgaaggggagtggaagggcattttgtgctggtggtgatatt
gtgtctctctaccatttaagaaagagaggtagcccggatgctattagggagtttttctcg
agtttgtatagttttatatacttgctaggcacatatctaaagccacatgtggcaattctt
aacggtgttactatgggaggcggaactggggtttcgatacctgggacatttcgtgtagct
actgatagaactatttttgctacccctgaaacaatcatcggttttcatcctgatgctggc
gcttcttttaacctctcccacttacctggtcgcttaggggagtatctgggtctgactggg
ttaaagctcagtggggcagaaatgttggcatgtggccttgcgacgcattatattagaagt
gaggagattcctgtaatggaagaacagctcaagaagctgctcactgatgatccttctgtt
gttgagtcatccttagaaaaatgtgcagaagttgcccatccggaaaagactggtgttatt
cgtaggatcgatttacttgaaaaatgcttcagccatgacacagtagaagaaattattgat
tctttggaaatcgaggctggtagaagaaaagatacatggtgcattacgactctacgtaga
cttaaagaaagctcaccgttatctttgaaggtggcattgagatctattcgggaaggaaga
ttacaaacacttgaccaatgcttaatccgagagtatagaatgtcgctacaaggattaatc
gggccaatgtccggcaatttttgcgagggagtacgagctcgactgatagacaaggacgaa
gcaccaaagtgggatccaccgagcttggagaaagtatcagaggacatggttgataattac
ttctcagccttgactcccacggaaccagatcttgagcttcctgtcaaactcagagaaagc
atttag

DBGET integrated database retrieval system