KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_487281Help
Entry
ARALYDRAFT_487281 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    ARALYDRAFT_487281
Enzymes [BR:aly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     ARALYDRAFT_487281
Chromosome and associated proteins [BR:aly03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     ARALYDRAFT_487281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 9307195
NCBI-ProteinID: XP_002873176
UniProt: D7LY76
Position
Unknown
AA seq 658 aa AA seqDB search
MEGNGGNYTDKTRVLDIKPLRTLRPVFPSGNQAPPFVCAPPFGPFPPGFSSFYPFSSSQA
SQHTPDLNQAQYPQQHQQPQNASEPSLVTPLRSFRSPDASNGNTELEGSTVKRKIPKRRP
IARPENMNFESGINVAERENGNRELVVSVLMRFDALRRRFAQLEDAKEAVSGIIKRPDLK
AGSTCMGRGVRTNTKKRPGIVAGVEIGDVFFFRFEMCLVGLHSPSMAGIDYLVVKGETEE
EPIATSIVSSGYYDNDEGNPDVLIYTGQGGNADKDKQSSDQKLERGNLALEKSLRRNSAV
RVIRGLKEASHNAKIYIYDGLYEIKESWVEKGKSGHNTFKYKLVRAPGQPPAFATWTAIQ
KWKTGLPSRQGLILPDMTSGVESIPVSLVNEVDTDNGPAYFTYSTTVKYSESFKLTQPSF
GCDCANSCKPGNLDCHCIRKNGGDFPFTGNGVLVSRKPMIYECSPSCPCSTCKNKVTQMG
VKVRLEVFKTANRGWGLRSWDAIRAGSFICIYAGEATDKSKVQQTMADDDYTFDTTHVYN
PFKWNYEPGLADEDASEEMSEESEIPLPLIISAKNVGNIARFMNHSCSPNVFWQPVTYEN
NSQLFVHVAFFAIAHIPPMTELTYDYGVSRPSRTENDNPLYGKKKCFCGSAYCRGSFG
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggaagggaatggtggtaactacactgataagacgagagtgttggatatcaagccattg
cgtactctaagacccgtgtttcccagtggaaatcaagctccgccttttgtctgtgcacct
ccttttggaccatttcctcctgggttctcatcgttttatccgtttagttcgtctcaagcg
agtcaacacacaccagatctcaatcaagctcagtatccacagcaacatcagcagccacag
aatgcatctgagccttctttggttactcctttaaggtcttttagatctcctgatgcgtct
aatggcaacacggagcttgaggggtcaactgtgaaaagaaagatccctaaaaggcgtcct
attgctcggcctgagaatatgaatttcgagagtgggattaacgtggctgaaagagagaat
ggcaatagggagttggtggtgagtgttcttatgcggtttgatgccttaagaagaaggttt
gcacaacttgaggatgcaaaggaagcagttagtgggattatcaaacgccctgatttgaaa
gcaggatctacttgtatgggcagaggggtccggacaaacaccaaaaaaagacctggtatt
gttgctggtgttgagatcggggatgtattcttcttcaggtttgagatgtgtttagtgggg
ttgcattctccatcaatggctgggattgactatttggttgtcaagggagaaacggaagaa
gaacctatcgccactagcattgtgtcatctggatattatgataatgacgaaggtaatccc
gatgttttgatttatactggtcagggtggtaatgctgataaagataagcaatcatctgac
caaaagctcgaaaggggtaatcttgccttggagaagagcttgcgtagaaatagtgcagtt
agggtaataaggggcttgaaagaggcttctcataatgctaagatctatatttatgatgga
ctctatgagattaaagagtcatgggtagagaaaggaaagtcgggacacaacaccttcaag
tataaactggttagagctcctggtcaacctcctgcatttgctacatggactgcaatccag
aaatggaagacgggtttgccttcaaggcaaggacttattcttcccgatatgacttctggg
gttgaaagtatacctgtttcacttgttaacgaagttgataccgacaatgggcctgcttat
ttcacctactccacaacggtgaaatactcagagtcgtttaagctgacacagccttctttt
ggatgtgattgtgccaattcatgcaaaccagggaacttggactgtcactgcataaggaaa
aatggaggtgatttccccttcaccggtaatggagttctagttagccgcaagcctatgata
tatgaatgcagtccatcttgcccgtgctcgacttgcaaaaacaaggtgactcaaatggga
gtaaaagtgaggctggaagttttcaagacagcgaatagaggatggggcttgcgctcatgg
gatgctattcgtgctggttcgtttatatgcatatatgcaggtgaggccacagacaaatcg
aaggtgcagcaaactatggctgatgatgattatacttttgatacaacccatgtctataac
cctttcaagtggaactatgagcctggcttagcagacgaagatgcttctgaagagatgtct
gaagaatctgaaatcccgctgccactgataatcagtgctaagaatgttgggaacattgcc
cgattcatgaatcatagttgctcacctaatgttttctggcagccggttacttatgaaaat
aacagtcaactcttcgtgcatgtcgccttctttgccattgctcacatccctccaatgact
gagttaacttacgactatggagtatctagaccaagtcggactgaaaatgacaatccttta
tatggcaaaaagaaatgcttttgtggatcagcgtattgccgtggctcatttggatga

DBGET integrated database retrieval system