KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_487470Help
Entry
ARALYDRAFT_487470 CDS       T01578                                 

Gene name
UBP12
Definition
ubiquitin-specific protease 12
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1115 aa AA seqDB search
MTMMTPPPVDQPEDEEMLVPNSDLVDGPAQPMEVIQPETAASTVENQPAEDPPTLKFTWT
IPNFSRQNTRKHYSDVFVVGGYKWRILIFPKGNNVDHLSMYLDVSDAASLPYGWSRYAQF
SLAVVNQIHSRYTIRKETQHQFNARESDWGFTSFMPLSELYDPSRGYLVNDTVLVEAEVA
VRKVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDLPTA
SIPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGT
VVEGTIQQLFEGHHMNYIECINVDFKSTRKESFYDLQLDVKGCKDVYASFDKYVEVERLE
GDNKYHAEGHGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLELDLD
RENGKYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKED
LKRALEEQYGGEEELPQTNPGFNNPPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAE
HLRVRLKKEQEEKEDKRRYKAQAHLYTIIKVARDEDLKEQIGKDIYFDLVDHDKVRSFRI
QKQTPFQQFKEEVAKEFGVPVQLQRFWIWAKRQNHTYRPNRPLTPQEELQQVGQIREASN
KANTAELKLFLEVEHLDLRPIPPPEKSKEDILLFFKLYDPEKAVLSYAGRLMVKSSSKPM
DITGKLNEMVGFAPDEEIELFEEIKFEPCVMCEHLDKKTSFRLCQIEDGDIICFQKPLVN
KEIECRYPAVPSFLEYVQNRQLVRFRALEKPKEDEFVLELSKLHTYDDVVEKVAEKLGLD
DPSKLRLTSHNCYSQQPKPQPIKYRGVDHLSDMLVHYNQTSDILYYEVLDIPLPELQGLK
TLKVAFHHATKEEVVIHNIRLPKQSTVGDVINELKTKVELSHPDAELRLLEVFYHKIYKI
FPSTERIENINDQYWTLRAEEIPEEEKNIGPNDRLILVYHFAKETGQNQQVQNFGEPFFL
VIHEGETLEEIKNRIQKKLHVSDEDFAKWKFAFMSMGRPEYLQDTDVVYNRFQRRDVYGA
FEQYLGLEHADTTPKRAYAANQNRHAYEKPVKIYN
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgactatgatgactccgcctcccgttgatcagccagaagatgaggagatgcttgtgccg
aattcagatttggtcgacggtcctgctcagcccatggaagttatccaacccgagactgct
gcgagtactgtggagaaccagccagctgaggatcctcctactctgaaattcacgtggact
atccctaatttctctaggcaaaataccaggaagcattactccgatgtatttgtcgttgga
ggttacaaatggcgcatattaattttcccgaaagggaacaatgttgatcatttgtccatg
tacttggatgtttctgatgctgcgagtttgccgtacggttggagcagatatgctcagttc
agtctggctgtagtcaatcaaatccactccagatataccattagaaaggagacgcaacat
caattcaatgctagagaaagcgattggggatttacatcattcatgcctcttagcgaactt
tatgatcctagtagaggatatttagtgaatgatactgttttggttgaagctgaagtcgct
gtacgtaaggttcttgattactggtcatatgactctaaaaaagagactggttttgttgga
ctcaagaaccaaggtgcaacttgttacatgaattctctcctacagacactataccacata
ccttacttcagaaaggctgtataccacatgccgacaactgagaacgatttacccacagca
agtatacctttggctctccaaagtttgttttacaagctccaatataatgacactagtgtt
gcaacaaaggagctgacaaagtcttttggttgggatacatatgattcctttatgcaacat
gatgtgcaagaactcaatcgggttctctgtgaaaagcttgaggacaaaatgaagggaact
gttgtggagggaacaatacaacaactatttgagggccaccatatgaattatattgagtgc
ataaatgtagatttcaaatcgacacggaaagaatcattttacgaccttcagctggatgtg
aaaggctgcaaggatgtttatgcttcttttgacaagtatgttgaagttgaacgtcttgaa
ggagataacaaatatcatgcagaaggacatggtttgcaggatgcaaaaaaaggtgttctt
ttcattgactttccaccggttcttcaactccagctcaagaggtttgaatatgactttatg
agggacaccatggtaaagataaacgatcggtatgagtttcctcttgaactggatcttgat
agagaaaatggaaagtatctgtctcctgatgctgacaggagtgtccgcaacctttatact
cttcacagtgtcttagttcatagtggaggagtacatggtgggcactattacgcttttata
aggcctacgctctcagatcagtggtataaatttgatgatgagcgtgtaacaaaggaagat
ttgaaaagggcattggaggagcaatatggtggtgaagaagagctaccacagactaatcct
ggtttcaataaccctcctttcaaattcacaaagtactcgaatgcttacatgcttgtatat
atccgggaaagtgacaaggataaaataatctgcaacgttgatgagaaagacatagcagaa
catttaagggtgaggctaaagaaagagcaagaagaaaaggaagataaaagaagatacaag
gcacaagctcacctatatacaataattaaggttgcaagagatgaagatcttaaggaacaa
atcgggaaggatatatattttgatcttgtggaccatgacaaagttcgcagtttccgtatc
cagaaacagacaccatttcaacagtttaaggaggaggtagccaaagaatttggtgtacct
gttcagttacagaggttctggatttgggctaagcgacaaaaccatacctatcgtcccaat
cgcccccttacgcctcaagaggaattacaacaggttggacaaataagagaagcatctaac
aaggcaaacactgcagaactaaagcttttcctggaagtagagcacctggatttacgtcct
attcctcctcctgaaaaatcaaaagaagatattctgcttttctttaagctttatgacccc
gagaaggcagtattaagctatgcaggcaggctgatggtgaaaagttccagtaagcctatg
gatataactggaaaactgaatgaaatggttggctttgctcctgatgaagaaatagaactt
tttgaggaaatcaagtttgaaccttgtgttatgtgcgaacacttggataagaaaacttca
ttcagattgtgtcaaattgaagatggagatatcatttgctttcagaaacctctagttaac
aaggagattgagtgccgctacccagctgtgccttcgtttcttgaatatgtccagaataga
cagctggtccggtttcgtgctctggaaaaacctaaagaagatgagtttgttctggagttg
tcgaagctgcacacttatgacgatgttgtggaaaaagtggctgagaagcttggtcttgac
gatccatccaaacttaggcttacatctcacaattgctattcccagcaacccaagcctcag
cctatcaaataccgtggagtagaccatttgtcagatatgttagttcactacaatcagacg
tctgacattttgtattatgaagttctggacattcctcttccagaattgcaaggtcttaaa
accttaaaagttgctttccatcatgccacgaaggaagaagtggtaatccacaatatcaga
ctacctaaacaaagcacggtcggagatgttattaatgaacttaaaacaaaggtggagctt
tcgcatccagatgcagaactgagattgctcgaggtgttttaccacaagatctacaagatt
ttcccatcaactgaaagaattgagaatataaatgaccagtactggactttacgagctgag
gagattccggaagaagagaagaatatcggtccaaatgatcgcttaattcttgtgtaccat
tttgctaaggagactggacaaaatcagcaagtgcaaaactttggcgagcccttcttcttg
gtaatccatgaaggtgaaactcttgaagaaataaagaaccgtatccaaaagaagcttcat
gtatccgatgaggactttgccaagtggaagtttgcgtttatgtcaatggggcgtccagag
tacttgcaggacacagatgttgtttataatcgctttcagagaagagatgtctatggtgct
tttgagcagtacctcgggttggagcatgctgacactactcctaagagggcttatgctgca
aaccagaaccgccacgcttacgagaagccggtgaaaatatacaattag

DBGET integrated database retrieval system