KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_487670Help
Entry
ARALYDRAFT_487670 CDS       T01578                                 

Gene name
ATAGAL2
Definition
alpha-galactosidase 2
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ARALYDRAFT_487670 (ATAGAL2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    ARALYDRAFT_487670 (ATAGAL2)
   00600 Sphingolipid metabolism
    ARALYDRAFT_487670 (ATAGAL2)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    ARALYDRAFT_487670 (ATAGAL2)
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ARALYDRAFT_487670 (ATAGAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 394 aa AA seqDB search
MVLIGFFLRFITFTLTLTQIVDGFQSRMLMHNGLALSPQMGWNSWNHFQCNINETLIKQT
ADAMVSSGLSAIGYKYINIDDCWGELKRDSQGSLVAKASTFPSGIKALSDYVHSKGLKLG
IYSDAGTLTCSQTMPGSLGHEEQDAKTFASWGIDYLKYDNCENTGTSPRERYPKMSKALL
NSGRSIFFSLCEWGQEDPATWAGDIGNSWRTTGDIQDNWKSMTLIADQNDRWASYARPGS
WNDPDMLEVGNGGMTKEEYRSHFSIWALAKAPLLIGCDLRSMDNVTFELLSNKEVIAVNQ
DKLGIQGKKIKKDGDLEVWAGPLSKKRVAVILWNRGSVSAKITARWADIGLSSSDIVNAR
DLWEHSTHSRVKNQLSALVEPHACKMYTLTRRKA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggttcttattggtttcttcttaagattcattaccttcactctgactctgactcagatc
gttgatgggtttcagagtcgaatgttgatgcacaatggacttgctctctctcctcaaatg
ggatggaacagctggaatcattttcagtgtaacatcaatgagaccctcatcaaacaaacc
gctgatgcaatggtttctagtggtctttctgcaataggttacaagtatatcaacatagat
gattgttggggtgaactcaaaagagattctcaggggagtttggttgcgaaagcatcgaca
tttccttcaggaatcaaggctttatcagattatgttcatagcaaagggctaaagcttggg
atatactctgatgccgggactcttacctgcagccaaaccatgccgggctcactcgggcat
gaagaacaagatgccaaaacatttgcctcatgggggattgattacctgaagtatgataac
tgcgaaaatactgggacaagtccaagagaaagataccctaagatgagcaaagctctgtta
aattcaggaagatccatattcttctctctgtgtgaatggggacaagaggatccagcaact
tgggcaggagatattggcaacagttggagaacaacaggagacatccaagataactggaaa
agcatgaccctgatagcagatcaaaatgaccgatgggcatcttatgcaagaccaggatcg
tggaacgatccagacatgcttgaagtgggaaatggagggatgactaaggaagaatacagg
tcgcatttcagcatctgggcattggcaaaagctcctctgctgatagggtgtgatcttaga
tcgatggacaatgttaccttcgagttgcttagcaacaaagaggtgattgctgttaatcaa
gacaaacttgggatccagggaaagaaaatcaagaaagatggtgatcttgaggtatgggca
ggtccgctaagcaagaaacgagtagcggtcatcctatggaacagaggatcagtatctgcc
aaaatcacagctcgatgggctgacattggccttagttcatcagatattgttaatgctcgt
gacttatgggagcattcgacacattcacgtgttaaaaatcaactctctgccttagtggag
cctcatgcctgcaaaatgtatactcttacaagacgcaaggcataa

DBGET integrated database retrieval system