KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_487672Help
Entry
ARALYDRAFT_487672 CDS       T01578                                 

Gene name
ATAGAL1
Definition
alpha-galactosidase 1
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aly00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aly00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aly00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:aly00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 430 aa AA seqDB search
MARTRAMVIKMSTLMILISLMVMNMVESSRSVNKVNNGDDSEILRRHLLTNGLGVTPPMG
WNSWNHFSCNIDEKMIKETADALVTTGLSKLGYKYVNIDDCWAEISRDSKGSLVPKKSTF
PSGIKALADYVHSKGLKLGIYSDAGYFTCSKTMPGSLGYEEHDAKTFAEWGIDYLKYDNC
NNDGSKPTVRYPVMTRALMKSGRPIFHSLCEWGDMHPALWGSPVGNSWRTTNDIKDTWLS
MISIADMNEVYAEHARPGGWNDPDMLEVGNGGMTKEEYIVHFSIWAISKAPLLLGCDIRN
MTKETVEIVANKEVIAINQEKESSCRSTRCQAKKVRMEGDLEVWAGPLSGYRVALLLLNR
GPSRTLITALWDDIEIPANSIVEARDLWQHKTLKQKFVGNLTATVDSHACKLYILKQSNL
LPEIHKERVN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaactagagcaatggtgataaagatgtcaacacttatgatactgatttcatta
atggtgatgaatatggtcgagtcttcgagatcagttaacaaggttaataatggtgacgat
tctgagatcttacgaagacacttgctcactaatggcctcggcgtcactcctcccatgggg
tggaatagctggaaccatttcagctgcaacatagatgagaaaatgatcaaagaaactgct
gatgctttggttactaccggcctctctaagcttggttacaaatacgttaacatcgatgat
tgttgggctgaaatttctcgtgacagcaagggaagtctggtgccaaagaagtcaactttc
ccttctggtattaaagcgcttgctgattatgttcatagcaagggccttaagctcgggatt
tactcagatgccgggtattttacctgcagcaaaaccatgccaggttctttaggctatgag
gagcatgatgccaagacatttgcagaatggggaattgattacttgaagtatgacaactgc
aacaacgatggctctaaaccgactgtcaggtatccggtgatgacccgagctctgatgaaa
tctggccgccccatctttcactcactgtgtgaatggggagatatgcatccagctctatgg
ggatctccagtaggcaacagttggagaaccactaatgacatcaaagatacttggcttagt
atgatctcaatagcagacatgaatgaagtctacgctgagcatgcaagacctggtggctgg
aacgacccggatatgcttgaagtgggaaatggaggaatgacgaaagaggagtacatagtc
catttcagcatatgggcaatctcaaaggctcctcttctacttggctgtgacataagaaac
atgaccaaggaaacagtggagattgtcgcaaacaaggaagtcatagctattaatcaagaa
aaggaaagttcttgtagatccacacggtgtcaggccaagaaagttagaatggaaggcgat
ctcgaggtttgggcaggaccattgtcaggttacagagtagctttgcttctgctgaaccgt
ggaccatcacgaactttgattactgctctctgggatgatattgagatccctgcaaatagc
attgttgaagccagagatctatggcagcacaagacattgaagcaaaagtttgtagggaac
ttgacagcaacagtggattctcatgcgtgtaagttgtatattctcaaacagtcaaacctg
ttgcctgaaatacataaagagagagttaattag

DBGET integrated database retrieval system