KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_487739Help
Entry
ARALYDRAFT_487739 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ARALYDRAFT_487739
  Energy metabolism
   00920 Sulfur metabolism
    ARALYDRAFT_487739
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    ARALYDRAFT_487739
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ARALYDRAFT_487739
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     ARALYDRAFT_487739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 345 aa AA seqDB search
MSYEKELAAAKKAVSLAARLSQEVQKSLLQSDVRSKSDKSPVTAADYGSQAVISHVLEKE
LHPEPLYLVAEENAEDLQKSGAEEFLESITKLVNNALPSDDSYANSSLSVEDVRKAIDHG
RSQGGSNGRHWILDPVDGTRGFVKGEDYAVALALLVEGKVVLGAMACPKLENHKSSSSGC
LFFATVGGGAYVQSLEGDSHPPQKVQVSNIENPEEATFVESSHKPIPIHSSIANKLGIKA
PPLRIHSQVKYAALARGDAEIYLRFTLKEYRESIWNHAAGAIITTEAGGVVCDANGNPLD
FSRGNHLEHKTGIVVSTQKLMPRILKAVRESMEEEKLLSETQLKL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatgagaaggagcttgctgctgctaaaaaagccgtctctctcgctgctcgtctc
agccaggaagtgcagaagtctctgttgcaatcagacgtccggtcaaaatctgataaaagt
ccggttacagctgctgattatggatcccaagctgtgatcagtcatgtgctagagaaagaa
cttcaccctgaaccactatacttggttgctgaagagaatgcagaagatctgcaaaagagt
ggcgcggaggaatttctagaaagcatcactaagcttgtgaacaatgctctaccttctgat
gattcctacgccaactcttctctttcagtggaagatgtaaggaaggcaatagaccacggg
aggtcacaaggcggttccaatggtcgccattggattcttgatcctgtggatggaaccaga
gggtttgtaaaaggagaggattacgctgtggcattggctttgcttgtggaaggcaaagta
gtgctcggtgccatggcttgcccgaaacttgagaatcacaagtcttcttcttcaggatgc
cttttctttgctacagtgggaggtggagcttacgtgcaatcgcttgaaggagactctcat
cctccacagaaggtgcaagtgagcaacattgagaatcctgaagaagcaacctttgtcgaa
tcatcccacaaaccaatccccatccatagctccattgccaataaacttgggatcaaagct
ccacctctaagaatccatagtcaagtgaagtacgctgctctagctcgaggagatgcagag
atatacttgcgtttcactctcaaagagtaccgtgagtccatatggaaccatgctgctggt
gcaatcatcaccacagaagctggaggtgtagtttgcgatgctaatgggaatcctctggac
ttctcgagaggaaatcatcttgaacacaaaacagggatcgtggtcagcacccagaagctc
atgccacggatcttgaaggccgtcagagaatccatggaagaggaaaagcttctctctgag
acgcaactgaaactgtaa

DBGET integrated database retrieval system