KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_487793Help
Entry
ARALYDRAFT_487793 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ARALYDRAFT_487793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 441 aa AA seqDB search
MGSSANTETNGNGAPPSSNQKPPATNGGDASHPPPPSSALDQAIIESDPSKKRKMGMLPL
EVGTRVMCRWRDGKHHPVKVIERRRIHNDYEYYVHYTEFNRRLDEWTQLDQLDLDSVECS
VDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGKYEI
ETWYFSPFPPEYNECVKLFFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMF
EVDGKKNKVYAQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSE
EAYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVL
LDILKKHKGNISIKELSDMTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRHLKAA
GRGGLDVDVSKLIWTPYRDQS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgtcagcgaatacagaaaccaacggcaacggagcaccaccgtcgtcgaatcaa
aagcctccggctactaacggcggtgatgcgtctcatcctcctcctccttcttcagctctt
gatcaagcgattatagagtcggatccgtcgaagaagaggaaaatggggatgcttcctcta
gaagtgggtactcgtgtgatgtgtcggtggagagacggaaaacaccatccggtcaaagta
attgagcgccggaggatacataatgattacgagtattacgttcattacactgagtttaat
aggagactggatgaatggactcagctggaccaactggaccttgattcagtagagtgttct
gtagatgaaaaagtggaagacaaggtaacgagcctgaagatgacacgacaccagaagagg
aagatcgatgagacacatgtagagggtcatgaagagctggatgcagcaagtttgcgtgaa
catgaagagttcacgaaagtgaagaacatagcaacgattgagcttggaaaatatgagatt
gagacttggtacttctccccttttccgccagaatacaatgaatgtgtgaagctctttttt
tgtgagttttgcctgaacttcatgaaacgcaaagaacagcttcaaaggcatatgaggaag
tgtgacctgaagcacccccctggtgatgaaatttatcgaagtggtaccttgtcaatgttt
gaggtagatggcaaaaagaacaaggtttatgcacagaatctctgttacctggcaaagtta
tttcttgaccacaaaactctttactacgacgttgatttgtttctgttctacgttctttgc
gaatgtgatgatcgaggatgccacatggttggttacttttcaaaggagaagcattcggaa
gaagcatacaacttagcttgcattctaaccctgcctccatatcaaagaaaaggctatgga
aaattcttaatagccttttcctacgaactgtcaaagaaagaaggaaaagttgggacaccg
gaaagacccttgtcggatctaggcttactaagctatagaggttattggactcgtgttcta
ttagatatcttgaaaaaacataaagggaacatatctatcaaggagctgagtgacatgaca
gcaatcaaggcggaagatatactaagcacacttcagagcctagaactgatacagtatagg
aaaggacaacacgtgatctgtgcggatccaaaggttctggaccgacatctgaaagctgca
ggccgaggtggtcttgatgtagatgttagcaaactgatttggacaccttacagggaccag
agttga

DBGET integrated database retrieval system