KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_487913Help
Entry
ARALYDRAFT_487913 CDS       T01578                                 

Gene name
UBP22
Definition
ubiquitin-specific protease 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ARALYDRAFT_487913 (UBP22)
Peptidases [BR:aly01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ARALYDRAFT_487913 (UBP22)
Transcription machinery [BR:aly03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     ARALYDRAFT_487913 (UBP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 557 aa AA seqDB search
MSARISFLKNLDPCNHLSDYKLRYGTDGYKSFNNLFRCFNDGRIKIKLQGFDIPRCSYCS
VYQKRLYICLICRSISCSSHILLHTQLNKGHDIAIDVERSELYCCACIDQVYDSEFDEVV
VSKQLIGLGMSVKSGADVVAVRSNKKRRLDSQLIIGSKFLVSPRDRREKWTFPLGLRGLN
NLGSTCFMNAVLQALVHAPPLRNFWLSGQHNRDLCPRRTMGLLCLPCDLDVIFSAMFSGD
RTPYSPAHLLYSWWQHSTNLATYEQQDSHEFFISLLDRIHENEGKSKCLYQDHEECQCIT
HKAFSGLLRSDVTCTTCGSTSTTYDPFIDISLTLDSVNGFSPADCRKNRYSGGPSVNATM
PTLSGCLDFFTRSEKLGPDQKLNCQSCGEKRESSKQMSIRRLPLLLCLHVKRFEHSLTRK
TSRKIDSYLQYPFRLNMSPYLSSSIIGKRFGNRIFAFDGEGEYDSSSSSSPSAEFEIFAV
VTHSGMLESGHYVTYLRLKGLWYRCDDAWINEVEEEVVRGCECYMLFYAQERVIQKAHKE
LSYQVISMADAFPFADC
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgaggatttcatttctgaaaaatctcgatccgtgcaatcacttatctgattat
aagcttagatatggtactgatggttacaaatctttcaataacttgttcagatgcttcaac
gatggaagaattaagatcaaacttcaaggattcgacatacccagatgcagttattgttct
gtttatcaaaagagactctacatctgtttgatctgtcgttccatttcttgttcaagtcat
atccttttgcatacccaattgaataaaggccatgatatcgccattgatgtcgaaagatct
gagctttattgttgtgcttgcatcgatcaagtgtatgattctgagttcgacgaggttgtt
gtgtctaagcagcttattggtttgggtatgtctgttaaatccggggctgatgttgttgcg
gttagatcgaacaagaagaggagattggattcgcaattgattatagggtccaagtttttg
gtctcacctcgagatcggagagagaaatggacgtttcctttggggttgagaggtttgaat
aatctgggaagcacttgttttatgaatgctgtgttgcaagcacttgttcatgctcctcct
ttgagaaacttttggttgagtggtcagcataatcgtgatctttgtcccagaaggacaatg
ggtttgttgtgtttgccttgtgatcttgatgttatcttctctgctatgttctctggtgat
cggactccttatagcccagctcatttgctttacagttggtggcagcactcaacgaatcta
gctacatatgagcagcaagattctcacgagttcttcatttcgctattggaccgcatccat
gagaatgaaggaaagtcgaaatgtctgtatcaagatcatgaggagtgtcaatgtattact
cacaaggcattctctggtcttttaagatcagatgtcacctgcacaacatgcggatccaca
tcaacaacatatgacccgtttatcgacatttcacttactttagattcagtgaatggattc
tctcccgctgattgcagaaagaacagatacagtggtggaccaagtgtgaacgcaaccatg
ccaactctctcgggttgcttagatttcttcacacggtcagagaaactcggtccggaccag
aaactaaactgccaaagctgtggagaaaagagagaatcttcgaaacaaatgtcaataaga
agacttcctctgcttctttgcttgcacgtaaagcgtttcgaacattctcttacccgtaaa
acctcgagaaaaattgatagctacttgcagtatccgttccgcctaaacatgtctccttac
ctctcttcctccatcatcggaaagcggtttgggaacagaatatttgcatttgatggagaa
ggcgagtatgacagttcatcatcatcatccccatcagcggaatttgagatatttgcggtt
gtaactcactcggggatgttggaatcaggtcactatgtgacgtatctgaggctcaaaggg
ttgtggtatagatgtgatgatgcatggatcaatgaggttgaagaagaagtggtgagagga
tgtgaatgttatatgttgttctatgcacaagaaagagtgattcaaaaagctcataaggag
ttgagttatcaagttatctccatggctgatgcatttccctttgctgattgctga

DBGET integrated database retrieval system