KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_488219Help
Entry
ARALYDRAFT_488219 CDS       T01578                                 

Definition
chalcone synthase
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    ARALYDRAFT_488219
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    ARALYDRAFT_488219
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     ARALYDRAFT_488219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 396 aa AA seqDB search
MVMAAGASSLDEIRKAQRADGPAGILAIGTANPENHVLQAEYPDYYFRITNSEHMTDLKE
KFKRMCDKSMIRKRHMHLTEDFLKENPHMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAI
KEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRIA
KDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGE
KPIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIVKSLDEAFKPLGIS
DWNSLFWIAHPGGPAILDQVELKLGLKEEKMRMTRHVLSEYGNMSSACVLFILDEMRRKS
AKDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggctgcaggagcttcttcgttggatgagatcagaaaggctcagagagctgat
ggacctgcagggatcttggctattggcacggctaaccctgagaaccatgtgcttcaggcg
gagtatcctgactactacttccgcatcaccaacagtgaacacatgaccgacctcaaggag
aagttcaagcgcatgtgcgacaagtcgatgattcggaaacgccacatgcatctgacagag
gacttcctcaaggaaaacccacacatgtgcgcttacatggctccttctctagacacccga
caggacatcgttgtggttgaagtccctaagctaggcaaagaagcggcagtgaaggccatc
aaggagtggggccagcccaagtcaaagatcactcatgtcgtcttctgcactacctctggc
gtcgacatgcctggtgctgactaccagctcaccaagcttcttggtctccgtccttccgtc
aagcgtctcatgatgtaccaacaaggttgcttcgccggcggcactgtcctccgtatcgcc
aaggacctggctgagaacaaccgcggagctcgtgtccttgtcgtctgctctgagatcaca
gctgtcaccttccgtggcccctctgacacccaccttgactccctcgtcggtcaggctctt
ttcagtgacggcgctgccgcactcatcgtggggtcggaccctgacacatctgtcggagag
aaacccatcttcgagatggtgtccgccgcacagaccatcctcccagactctgatggtgcc
atagacggacacttgagggaagtgggtctcaccttccatctcctcaaggatgttcccggc
ctcatctcgaagaacattgtgaagagtttagacgaagcgtttaaacctttggggataagt
gactggaactccctcttctggatagctcaccctggaggtcctgcgatcctagatcaggtg
gagttaaagctaggactaaaggaagagaagatgaggatgacacgtcacgtgttgagcgag
tatggaaacatgtcgagcgcgtgcgttctcttcatactagacgagatgaggagaaagtca
gccaaggatggtgtggccacgacaggggaagggttggagtggggagtcttgtttggtttc
ggaccaggtctcactgttgagacagtcgtcttgcacagcgttcctctctaa

DBGET integrated database retrieval system