KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_488256Help
Entry
ARALYDRAFT_488256 CDS       T01578                                 

Definition
HEMG2/MEE61
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARALYDRAFT_488256
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ARALYDRAFT_488256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 512 aa AA seqDB search
MESGAVGDHDTKFESISGKRVAVVGAGVSGLAAAYKLKSRGLNVTVFEADERAGGKLTSV
MQNGLIWDQGANTMTEAEPEVGSLLDDLGLRDKQQFPISQKKRYIVRNGLPMMLPTNPIE
LVTSSVLSTQAKIQILLEPFLWKKNDSSSKVSDASAEESVSGFFQRHFGQEVVDYLIDPF
VGGTSAADPDSLSMKHSFPDLWNVEKSFGSIIVGAIRTKLAAKGGKSGEAKSSPGTKRGS
RRSFSFKGGMQILPDMLCKSLSHDEINLDSKVLSLSYNSGSRQENWSLSCVSHNETQRQN
LHYDAVVMTAPLCNVKEMKVTKGGQPFLLNFLPEINYMPLSVLITTFTKEKVKRPLEGFG
VLIPSKEKKHGFKTLGTLFSSMMFPDRCPSDLHLYTTFIGGSRNQELAKASTDELKQVVT
SDLQRLLGVEGEPVSVNHYYWRKAFPLYDSSYGSVMEAIDKMEKDLPGFFYAGNHRGGLS
IGKSIASGCKAADLVISYLESCSNDKKPDESL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggagcagtaggtgatcatgatacaaaatttgaatcgatttccgggaaaaga
gtcgcagtcgtaggtgcaggtgtaagtggtctagcggcggcttacaaattgaaatcgagg
ggtttgaatgtgactgtgtttgaagctgatgaaagagcaggtgggaagttgacaagtgtt
atgcaaaatggcttgatttgggaccaaggagcaaacaccatgactgaggctgagccagaa
gttgggagtttgctcgatgatcttgggcttcgtgacaaacaacaatttccaatttcacag
aaaaagcggtatattgtgcggaatggtctgcctatgatgctacctaccaatcccatagag
ttggtcacaagtagtgtactctctacccaagctaagattcaaatcttgttggaaccattt
ctttggaagaaaaatgactcgtcctcaaaagtctcagatgcatctgctgaagaaagtgta
agtgggttctttcaacgccattttggacaagaggttgtggactatctcatcgaccctttt
gttggtggaacaagtgctgcggaccctgattccctttcaatgaagcattcttttccagat
ctctggaatgtagagaaaagttttggctctattatagtcggtgcaatcagaacaaagttg
gctgctaaagggggtaaaagtggagaagcaaagagttctcctggcacaaaaaggggttcg
cgcaggtcattctcttttaaggggggaatgcagattcttcctgatatgttgtgcaaaagt
ctctcacatgatgagatcaatttagactccaaggttctctctttgtcttacaattctgga
tcaagacaggagaactggtcactatcttgtgtttcacataatgaaacgcagagacaaaac
ctccattatgatgctgtagttatgacggctcctctgtgcaatgtgaaggaaatgaaggtt
acgaaaggagggcaaccctttctgctaaactttctccccgagattaattacatgcccctc
tcggttttaatcaccacattcacaaaggagaaagtaaagagacctcttgaaggctttggg
gtactcattccatctaaggagaaaaagcatggtttcaaaactctaggtacactgttctca
tcaatgatgtttccagatcgttgccctagtgaccttcatctatatacaacttttattggt
gggagtaggaaccaggaactggccaaagcttccacagacgaattaaaacaagttgtgact
tctgaccttcagcgactgttgggggttgaaggtgaacccgtgtctgtcaaccattactat
tggaggaaagcattcccgttgtatgacagcagctatggctcagtcatggaagcaattgac
aagatggagaaagatctacccgggttcttctacgcaggtaatcatcgaggcgggctctct
attgggaaatcaatagcatcaggttgcaaagcagctgatcttgtgatctcatacctggag
tcttgctcaaatgacaagaaaccagatgagagcttatga

DBGET integrated database retrieval system