KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_488676Help
Entry
ARALYDRAFT_488676 CDS       T01578                                 

Definition
cap-binding protein nCBP
Orthology
K03259  
translation initiation factor 4E
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:aly03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 221 aa AA seqDB search
MEVADRRDEEIRDSGNMDSIKSQYVTDSVSEERRSRELKDGLHPLRYKFSIWYTRRTPGV
RNQSYEDNIKKIVEFSTVEGFWACYCHLARSSLLPSPTDLHFFKDGIRPLWEVGANCNGG
KWIIRFSKVVSARFWEDLLLALVGDQLDDADNICGAVLSVRFNEDIISVWNRNASDHQAV
MGLRDSIKRHLKLPHAYVMEYKPHDASLRDNSSYRNTWLRG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgcggataggagagacgaggagatcagggactctggaaacatggacagcatc
aagtcccaatatgttaccgactctgtttccgaagaacgtcgctctcgtgagctcaaggat
ggtctccatcctctacggtacaagttttcgatatggtacactcgtcgcacaccaggggtt
cggaaccaatcttatgaggataacattaagaagattgtggaattcagcactgttgaaggg
ttttgggcctgctactgtcaccttgctcgttcttctctcttgcctagtccaacagatctt
catttctttaaggatgggattcgtccgttgtgggaggtaggtgccaactgcaatggagga
aagtggatcattcgtttctcaaaagttgtatctgctcgcttctgggaggatctgcttctt
gcattggtaggcgaccagcttgacgacgctgataacatatgtggggcagtactgagtgtc
cgcttcaatgaggacatcattagtgtatggaatcgcaatgcttctgaccatcaggcagtg
atgggtttgagagactcaatcaagcggcatttgaagttgccccatgcatatgtcatggaa
tacaagccccacgatgcttctctccgcgacaactcttcctacagaaacacatggctgaga
ggatag

DBGET integrated database retrieval system