KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489563Help
Entry
ARALYDRAFT_489563 CDS       T01578                                 

Definition
TIF3B1
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARALYDRAFT_489563
Translation factors [BR:aly03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    ARALYDRAFT_489563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 713 aa AA seqDB search
MEVVDIDARAAKLGINWSQVNFDSIQLPPGEDFGIESDDEAVYHDDQSEFDTGFGNIIVV
DHLPVVPKEKFEKLEGVVKKIYNQLGVIKENGLWMPVDPDTKMTLGYCFIEFNTPQEAQN
AKEKSHGYKLDKSHIFAVNMFDDFDRLMNVREEWEPPQARPYVPGENLQKWLTDDKARDQ
LVIRSGPDTEVYWNDARQKKPEPVHKRPYWTESYVQWSPLGTYLVTLHKQGAAVWGGADT
FTRLMRYQHSMVKLVDFSPGEKYLVTYHSQEPSNPRDASKVEIKVFDVRTGRMMRDFKGS
ADEFSIGGPGGVAGASWPVFRWAGGKDDKYFAKLSKNTISVYETETFSLIDKKSMKVDNV
VDICWSPTDSILSLFVPEQGGGNQPAKVALVQIPSKVELRQKNLFSVSDCKMYWQSSGEY
LAVKVDRYTKTKKSTYSGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHG
DQPRPDVSFYSMKTTQNTGRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFN
VDELETMATAEHFMATDIEWDPTGRYVATAVTSVHEMENGFTIWSFNGIVIYRILKDHFF
QLAWRPRPPSFLTAEKEEEIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALKDEWEKW
VMQWKALHEEEKLARQNLRDGEVSDVEEDEYEAKEVEFEDLIDVTEEIVQESM
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcgttgatattgatgctcgagcagctaagttagggattaattggtctcaggtt
aattttgattccatccaacttcctcctggagaagactttgggattgagagtgatgatgaa
gctgtttaccacgatgaccagtcagaattcgacactggattcggtaacattatcgtggtt
gatcacctccctgttgttcccaaggagaagtttgagaaacttgaaggtgttgtcaagaaa
atttacaaccagttaggtgtgatcaaggaaaatggactgtggatgcccgttgatcccgac
accaagatgacattgggctactgttttattgagttcaatactcctcaggaagcacaaaac
gctaaggaaaagtctcatggctacaagttggacaagtctcacatctttgctgtaaacatg
ttcgatgatttcgacaggttgatgaatgtgcgggaggagtgggagcctcctcaggccagg
ccgtatgtccctggggaaaatttacaaaagtggcttactgatgacaaagcccgggaccag
ctagttattcgttctggccctgatactgaagtttactggaatgatgctaggcagaagaag
cctgaacctgttcataagcgtccttattggacagagagttatgtgcagtggtctccttta
ggtacataccttgtgacacttcacaagcagggggcagctgtttggggtggtgctgataca
ttcacacgtctcatgcgttatcagcattctatggttaaactagttgatttctcaccaggt
gagaaatatctggtaacttaccacagccaagaaccaagcaacccgcgggatgcaagtaaa
gtagagattaaggtttttgatgtgagaactgggaggatgatgagagatttcaagggtagt
gctgatgagttttcaattggaggacctggtggtgttgctggtgcctcttggcctgttttc
agatgggctggtggaaaagatgataaatactttgccaagcttagcaaaaacactatctcc
gtctatgagactgagactttcagcctaatagacaagaaatccatgaaggttgataatgtt
gtggatatctgctggtctcctactgattccatcctttcattgtttgttcctgaacaaggt
ggtggaaaccaacctgccaaggtcgctctagtccaaatcccgagcaaggtggagctgagg
cagaagaatctcttcagtgtgagcgactgcaagatgtactggcagagtagtggagagtat
cttgctgtcaaggttgatcggtacacgaaaactaagaagagcacatactctggatttgag
cttttccgtatcaaagaaagggatattcccatcgaggttcttgagctggacaacaagaac
gacaagatcattgctttcgcgtgggagcccaagggtcacaggtttgctgtgattcatggt
gaccaaccaagaccagacgtcagtttctactcaatgaagaccacacaaaacactggaagg
gtttcaaagctcgcaactttgaaggccaaacaagctaatgccctcttctggtcgcccaca
ggcaagtacataattcttgctgggttaaaaggtttcaatggccagcttgagtttttcaac
gtggatgagctcgagacaatggccacagctgaacacttcatggccactgatatcgaatgg
gacccgactggaaggtacgtagcaaccgcggtgacatcagtccacgagatggagaatggg
ttcaccatatggtctttcaacgggattgtgatttaccggatactgaaggatcatttcttc
cagttggcctggcgtccaagaccgccatcattcttgactgcagagaaggaagaagagata
gcaaagaacctgaagaagtacagcaagaagtatgaggcagaggatcaggacgtgtcgttg
ctgttgagtgaacaagacagagagaagaggaaggcattaaaggacgaatgggagaaatgg
gtgatgcagtggaaggctctgcatgaagaggagaaactcgcgaggcaaaatcttcgggat
ggtgaagttagtgatgtggaagaagatgagtatgaagccaaagaagttgagtttgaggat
cttattgatgtcactgaggaaatcgttcaggagtcgatgtaa

DBGET integrated database retrieval system