KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489579Help
Entry
ARALYDRAFT_489579 CDS       T01578                                 

Definition
seryl-tRNA synthetase
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    ARALYDRAFT_489579
Enzymes [BR:aly01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     ARALYDRAFT_489579
Amino acid related enzymes [BR:aly01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   ARALYDRAFT_489579
Transfer RNA biogenesis [BR:aly03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ARALYDRAFT_489579
 Prokaryotic Type
    ARALYDRAFT_489579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 451 aa AA seqDB search
MLDINLFREEKGNNPEIIRESQRRRFASVEVVDEIIKLDKEWRQRQFEVDSFRKEFNKLN
KQVAQLKIKKEDATEIIQQTEKNKQDSTAKEAEVREAYAALKAKLETVGNLIHDSVPIDK
DEANNLVIKLWGEKRFSTPGLKLKNHVDLVELLGIADTKRGAEIAGARGFFLKGDGLMLN
QALINFGLTFLKKRGFTGLQPPFFMRKDVMAKCAQLAQFDEELYKVTGEGDDKYLIATAE
QPLCAYHLDEWIHPTELPLRYAGYSSCFRKEAGSHGRDTLGIFRVHQFEKIEQFCITGPN
ENASWEMLDEMMKNSEDFYQALKLPYQIVSIVSGALNDAAAKKYDLEAWFPSSETFRELV
SCSNCTDYQARRLEIRYGQKKSNEQTKQYVHMLNSTLTATERTICCILENYQREDGVDIP
EVLQPFMGGETFLPFKAKPVVADTKGKKSKA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttggatatcaatctatttcgtgaagaaaaagggaacaatccggagattatcagagaa
tcgcaacgccggagatttgccagcgttgaagtcgttgatgagatcattaaactcgacaaa
gaatggcgtcagcgtcaatttgaagttgatagtttcaggaaagagttcaacaagctcaat
aagcaagtggcgcagctcaaaattaaaaaagaagatgcgactgagattattcaacagacc
gagaaaaacaaacaagattctaccgcaaaggaggcggaagttcgtgaagcttatgctgct
ttgaaagccaagttggagacagttggtaacttgattcatgactcggttcctattgataag
gacgaggctaataatcttgtgattaaactgtggggtgaaaagcggttttctacgcctggt
ctgaagctgaaaaatcatgtggatctcgttgagcttctcggtattgcagataccaaaaga
ggtgctgaaatcgctggagccagaggctttttcttaaaaggagatggtttgatgcttaac
caagctcttatcaactttgggctaactttcttgaaaaagagaggattcacaggattgcag
cctccttttttcatgaggaaggatgttatggccaagtgcgcacaattggcacagttcgat
gaagagctttacaaggtgactggtgaaggagatgacaaataccttattgcaactgctgag
cagcctctttgtgcataccatcttgatgaatggattcatccgactgagcttcccctaaga
tatgctggttactcgtcctgctttagaaaagaagctggttcgcatggaagagacacactt
ggtattttccgtgttcaccagtttgagaaaattgaacagttttgcatcaccggtcctaat
gagaatgcctcgtgggaaatgcttgatgagatgatgaagaactcggaagatttttaccaa
gcgctaaagcttccataccaaattgtgtcaatagtctctggagcattgaacgatgcagct
gcgaaaaagtatgacttggaagcttggtttccttcgtcggagacattcagagagcttgtg
tcctgttccaactgcacagactaccaggctcgaagacttgagatcagatacggtcagaaa
aagagcaatgagcagacaaagcagtatgtgcatatgctgaattcgacacttactgcaaca
gagaggaccatttgctgcattctcgagaactaccagcgagaggatggtgtggacatccct
gaggttctgcagccgtttatgggtggagagacgtttttgcctttcaaggccaagcccgta
gttgctgataccaaagggaagaaatcgaaagcttga

DBGET integrated database retrieval system