KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489579Help
Entry
ARALYDRAFT_489579 CDS       T01578                                 

Definition
seryl-tRNA synthetase
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:aly00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 451 aa AA seqDB search
MLDINLFREEKGNNPEIIRESQRRRFASVEVVDEIIKLDKEWRQRQFEVDSFRKEFNKLN
KQVAQLKIKKEDATEIIQQTEKNKQDSTAKEAEVREAYAALKAKLETVGNLIHDSVPIDK
DEANNLVIKLWGEKRFSTPGLKLKNHVDLVELLGIADTKRGAEIAGARGFFLKGDGLMLN
QALINFGLTFLKKRGFTGLQPPFFMRKDVMAKCAQLAQFDEELYKVTGEGDDKYLIATAE
QPLCAYHLDEWIHPTELPLRYAGYSSCFRKEAGSHGRDTLGIFRVHQFEKIEQFCITGPN
ENASWEMLDEMMKNSEDFYQALKLPYQIVSIVSGALNDAAAKKYDLEAWFPSSETFRELV
SCSNCTDYQARRLEIRYGQKKSNEQTKQYVHMLNSTLTATERTICCILENYQREDGVDIP
EVLQPFMGGETFLPFKAKPVVADTKGKKSKA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttggatatcaatctatttcgtgaagaaaaagggaacaatccggagattatcagagaa
tcgcaacgccggagatttgccagcgttgaagtcgttgatgagatcattaaactcgacaaa
gaatggcgtcagcgtcaatttgaagttgatagtttcaggaaagagttcaacaagctcaat
aagcaagtggcgcagctcaaaattaaaaaagaagatgcgactgagattattcaacagacc
gagaaaaacaaacaagattctaccgcaaaggaggcggaagttcgtgaagcttatgctgct
ttgaaagccaagttggagacagttggtaacttgattcatgactcggttcctattgataag
gacgaggctaataatcttgtgattaaactgtggggtgaaaagcggttttctacgcctggt
ctgaagctgaaaaatcatgtggatctcgttgagcttctcggtattgcagataccaaaaga
ggtgctgaaatcgctggagccagaggctttttcttaaaaggagatggtttgatgcttaac
caagctcttatcaactttgggctaactttcttgaaaaagagaggattcacaggattgcag
cctccttttttcatgaggaaggatgttatggccaagtgcgcacaattggcacagttcgat
gaagagctttacaaggtgactggtgaaggagatgacaaataccttattgcaactgctgag
cagcctctttgtgcataccatcttgatgaatggattcatccgactgagcttcccctaaga
tatgctggttactcgtcctgctttagaaaagaagctggttcgcatggaagagacacactt
ggtattttccgtgttcaccagtttgagaaaattgaacagttttgcatcaccggtcctaat
gagaatgcctcgtgggaaatgcttgatgagatgatgaagaactcggaagatttttaccaa
gcgctaaagcttccataccaaattgtgtcaatagtctctggagcattgaacgatgcagct
gcgaaaaagtatgacttggaagcttggtttccttcgtcggagacattcagagagcttgtg
tcctgttccaactgcacagactaccaggctcgaagacttgagatcagatacggtcagaaa
aagagcaatgagcagacaaagcagtatgtgcatatgctgaattcgacacttactgcaaca
gagaggaccatttgctgcattctcgagaactaccagcgagaggatggtgtggacatccct
gaggttctgcagccgtttatgggtggagagacgtttttgcctttcaaggccaagcccgta
gttgctgataccaaagggaagaaatcgaaagcttga

DBGET integrated database retrieval system