KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489723Help
Entry
ARALYDRAFT_489723 CDS       T01578                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ARALYDRAFT_489723
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ARALYDRAFT_489723
Enzymes [BR:aly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ARALYDRAFT_489723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 342 aa AA seqDB search
MSKIIGKRGINYIHRLNSASFTSVSASSIEKGQNRVIDASLTLIRERAKLKGELVRLLGG
AKASTSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEEGKELKDPRVLTDVGDV
PVQEIRDCGVDDDRLMNVISESVKLVMDEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVD
ILHLDAHPDIYDCFEGNKYSHASSFARIMEGGYARRLLQVGIRSINQEGREQGKRFGVEQ
YEMRTFSKDRPMLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILH
NLQADVVGADVVEFNPQRDTVDGMTAMVAAKLVRELAAKISK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagattattgggaaaagagggattaactatatccatagactcaattctgcgtcg
ttcacgagcgtatctgcttcatcaatcgagaaagggcaaaatcgtgtcattgatgcttcg
ttaactctcattcgtgaaagggcaaaactaaaaggagagttagtgcgtcttttaggtgga
gctaaagcttcaacatctcttcttggagtaccacttggtcacaactcttcttttcttcaa
ggtcctgcttttgctcctcctcgtattagagaagctatttggtgtggtagtacaaactct
gcaactgaagaagggaaggagttgaaggatccacgggttctaactgatgttggggatgtt
ccggtacaagagattagagattgtggggttgatgatgatagactgatgaatgttataagt
gaatctgtgaagttggtgatggatgaggaaccattgcgcccgctggtcctaggtggagac
cattctatatcttatcctgttgtgagagcggtttctgagaagcttggagggcctgtggac
attctgcatcttgatgcacatccggatatatatgattgttttgaaggaaataagtactct
catgcatcttcttttgctcgtatcatggaaggtggctatgcgcgtaggcttttacaggtt
gggatcagatcgataaaccaggaaggacgggaacaaggcaagaggtttggagtagaacag
tatgagatgcgaaccttctcaaaagatcgtccaatgttggaaaatctgaaattaggggaa
ggagtgaagggggtatacatctcgatagacgttgactgtcttgatccggcatttgcaccc
ggagtgtcccacatcgaaccaggaggtctctctttccgtgatgtcctaaacatcttacat
aatcttcaggcagatgttgtcggggctgatgttgtcgagttcaacccgcaacgtgatact
gttgacggcatgacagcaatggtcgctgctaagcttgttagagaattagccgcgaaaatc
tcgaaatga

DBGET integrated database retrieval system