KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489849Help
Entry
ARALYDRAFT_489849 CDS       T01578                                 

Gene name
CYTC-2
Definition
cytochrome C-2
Orthology
K08738  
cytochrome c
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:aly00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 112 aa AA seqDB search
MASFDEAPPGNPKAGEKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAA
NKSMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGTA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttcgatgaagcacctcccggaaaccccaaagccggtgaaaagatcttcaga
accaaatgcgctcagtgtcacaccgtcgaaaaaggcgccggtcacaaacaaggaccgaat
ttgaatggattgtttggaagacaatctggaacaacaccaggatattcttactctgctgct
aacaaaagcatggctgtgaattgggaggagaagactctttacgattacttgttgaatcct
aaaaagtacattcctggaacgaaaatggtgtttcctggactgaaaaagccgcaagatcgt
gccgatctcatcgcttacttgaaggaaggtactgcataa

DBGET integrated database retrieval system