KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489959Help
Entry
ARALYDRAFT_489959 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    ARALYDRAFT_489959
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     ARALYDRAFT_489959
Protein phosphatases and associated proteins [BR:aly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     ARALYDRAFT_489959
Transcription machinery [BR:aly03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     ARALYDRAFT_489959
Spliceosome [BR:aly03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    ARALYDRAFT_489959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 322 aa AA seqDB search
MDETLLDDIIRRLLATNNGRTVKQAQITEAEIRQLCLASKEVFLSQPNLLELEAPIKICG
DVHGQFPDLLRLFEYGGYPPAANYLFLGDYVDRGKQSIETICLLLAYKVKYKFNFFLLRG
NHECASINRVYGFYDECKRRYNVRLWKTFTECFNCLPVSALIDDKILCMHGGLSPDIKSL
DDIKRIPRPIDVPDEGILCDLLWADPDREIEGWGENDRGVSYTFGADKVAEFLQTHDLDL
VCRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGALMSVDDSLTCSFQILKASEKKG
RFGFNNHVPRPGTPPHKGGKGR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggacgagactttacttgacgacataatacggcgacttttagcgacgaataatggaagg
acggtgaagcaagcacagattactgaggcggagatacggcagctatgtttagcttccaag
gaagtttttctcagtcagcctaatctcctcgagcttgaggctcctatcaagatttgtgga
gatgttcatggtcagtttccagatctcctgcggttgtttgagtatggtggctatcctcca
gctgcaaattacttgtttctcggggactatgttgatcgtggtaagcagagcatagagact
atatgtcttcttcttgcatacaaggtcaaatacaagttcaacttctttcttctcagaggc
aatcacgagtgtgcttcaatcaatcgtgtatatggattctatgatgaatgcaaaagaaga
tataatgtccggttatggaaaactttcactgagtgtttcaactgtctgcctgtttctgct
ctcattgatgataagatcctctgcatgcatggtggactatcgcctgatattaagagctta
gatgacatcaagagaattcctcgtcctattgatgttcctgatgagggcattctttgtgat
ttgttatgggctgatcctgacagagagattgaaggctggggggagaatgacagaggtgtc
tcttatacatttggggccgacaaagtagctgagttccttcaaactcatgaccttgatctt
gtatgccgagctcatcaggttgtagaagatggatatgaattctttgcgaaaagacaactg
gtgacaatattctctgcacccaattactgtggcgagtttgacaatgctggcgcattgatg
agtgttgatgatagcttaacatgttcattccaaatccttaaggcatctgagaagaaagga
agatttggattcaacaaccatgttcctagaccaggaaccccacctcataagggtggaaaa
ggtcgttaa

DBGET integrated database retrieval system