KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489959Help
Entry
ARALYDRAFT_489959 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:aly03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 322 aa AA seqDB search
MDETLLDDIIRRLLATNNGRTVKQAQITEAEIRQLCLASKEVFLSQPNLLELEAPIKICG
DVHGQFPDLLRLFEYGGYPPAANYLFLGDYVDRGKQSIETICLLLAYKVKYKFNFFLLRG
NHECASINRVYGFYDECKRRYNVRLWKTFTECFNCLPVSALIDDKILCMHGGLSPDIKSL
DDIKRIPRPIDVPDEGILCDLLWADPDREIEGWGENDRGVSYTFGADKVAEFLQTHDLDL
VCRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGALMSVDDSLTCSFQILKASEKKG
RFGFNNHVPRPGTPPHKGGKGR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggacgagactttacttgacgacataatacggcgacttttagcgacgaataatggaagg
acggtgaagcaagcacagattactgaggcggagatacggcagctatgtttagcttccaag
gaagtttttctcagtcagcctaatctcctcgagcttgaggctcctatcaagatttgtgga
gatgttcatggtcagtttccagatctcctgcggttgtttgagtatggtggctatcctcca
gctgcaaattacttgtttctcggggactatgttgatcgtggtaagcagagcatagagact
atatgtcttcttcttgcatacaaggtcaaatacaagttcaacttctttcttctcagaggc
aatcacgagtgtgcttcaatcaatcgtgtatatggattctatgatgaatgcaaaagaaga
tataatgtccggttatggaaaactttcactgagtgtttcaactgtctgcctgtttctgct
ctcattgatgataagatcctctgcatgcatggtggactatcgcctgatattaagagctta
gatgacatcaagagaattcctcgtcctattgatgttcctgatgagggcattctttgtgat
ttgttatgggctgatcctgacagagagattgaaggctggggggagaatgacagaggtgtc
tcttatacatttggggccgacaaagtagctgagttccttcaaactcatgaccttgatctt
gtatgccgagctcatcaggttgtagaagatggatatgaattctttgcgaaaagacaactg
gtgacaatattctctgcacccaattactgtggcgagtttgacaatgctggcgcattgatg
agtgttgatgatagcttaacatgttcattccaaatccttaaggcatctgagaagaaagga
agatttggattcaacaaccatgttcctagaccaggaaccccacctcataagggtggaaaa
ggtcgttaa

DBGET integrated database retrieval system