KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489982Help
Entry
ARALYDRAFT_489982 CDS       T01578                                 

Definition
ATGPX6
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aly00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aly00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 235 aa AA seqDB search
MLRSSIRLLYIRRTSPLLRSLSSSSSSSSSSSSKRFDSAKPLFNSHRIISLPISTTGAKL
SRSEHSMATSSEPKSIYDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELAQ
LYEKYKDHGFEILAFPCNQFGNQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDKAAPIY
KFLKSSKGGLFGDGIKWNFAKFLVDKDGNVVDRYAPTTSPLSIEKDLKKLLGVTA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgatcctcaattcgacttctctatataagaagaaccagtcctctccttcgaagt
ttatcatcatcatcatcatcatcatcatcatcttcatcaaaacgattcgattctgcgaaa
ccacttttcaattctcatcggattatttctcttccaatctctacaacgggtgctaaactt
tctagatcggaacattcaatggctacttcttccgaacccaaatctatctacgatttcacc
gtcaaggatgctaagggaaacgatgttgatctaagcatctacaaggggaaggttcttttg
attgtgaacgttgcttctcaatgtggcttgactaattcgaactatactgagcttgcacag
ctttatgagaagtacaaagaccatgggtttgagattcttgcgttcccgtgtaatcagttt
gggaatcaagagcctggtacaaatgaagagattgttcagtttgcttgtactcgtttcaag
gctgagtacccgattttcgacaaggttgatgtgaacggtgacaaagctgctccaatctac
aagtttctgaaatcaagcaaaggcgggctttttggagacggcatcaagtggaacttcgct
aagttcttggttgacaaagatggaaatgttgttgaccgttacgcgccaactacttctcct
ctcagtattgagaaggacctgaagaaactgttgggagttactgcttaa

DBGET integrated database retrieval system