KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_490084Help
Entry
ARALYDRAFT_490084 CDS       T01578                                 

Definition
malonyl-CoA decarboxylase family protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aly00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:aly00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:aly04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 523 aa AA seqDB search
MSKKNLAILLRARMKSNNPTKFSLSQFPEIQSNPQENQSEDHIVQNSSEGIGNSSDFGNT
GRIYDVVRETMHSAISASKTGVLDITLSDFQEGYFSLSLEDREKLLLVLAKEYDVNREQV
RELVKQYLGLENPASDDKDVLSSVFYRTERNLRHTLRPTYEVLFERLNTHPGGLRFLSIL
RADLLSVLTKENSPSLRTLDSFLKEKLGMWLSPASLELHQITWDDPASLLEKIVAYEAVH
PISNLLDLKRRLGIGRRCFGYFHPSIPGEPLIFIEVALMETVAQTIQEVLWDNPPIPENQ
ATCALFYSISSTQPGLAGINLGKFLIKRVITLVKKDMPHVSTFATLSPIPGFMQWLLSKL
SSQSRFAEDERSTQSNSPSSTFSEKVLLPEEEQALMSLSDDSPSGSNGMEVLLNLLSVKN
CDWATSPRLLPVLEPILMRLCARYLLQEKKRGKALDSVANFHLQNGAMVERINWMADRSE
KGIHQSGGIMVNYVYRLENIEDYAQSYFGSGKIHASPGIHSRL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaaaatctagcgattctgctgcgtgctagaatgaaatccaacaatcccacc
aaattttccctctctcaatttcctgaaattcaatctaatcctcaagagaatcaatctgaa
gatcacattgtacaaaattccagtgaaggaattgggaattctagtgattttggtaacaca
ggaaggatatatgatgttgttcgagaaacaatgcactcggctatctcagcgagtaaaacc
ggtgtattagacattactcttagtgattttcaagagggttactttagcctttcgcttgaa
gaccgtgagaaattactgcttgttttagccaaagaatatgatgttaaccgggagcaagtt
cgtgaacttgttaagcaatatcttggacttgaaaatccagctagtgatgataaggatgtt
ttatcttctgttttctatcgcactgagcggaatttgagacatactcttaggccaacatat
gaagttctatttgagaggttgaatacccatccaggagggttgagatttttgtccatcctc
cgtgctgatcttctttcggtactcacaaaagaaaactcgccgtctctgcgaacattagat
tcctttctaaaggagaaactcggtatgtggcttagtcctgccagtttagagcttcatcaa
attacttgggatgatcctgcttcattgcttgagaaaattgtcgcatacgaggcggtacat
cctatcagcaacctcttggatcttaaaagaagattgggaataggccgtcgatgctttgga
tattttcatccatctatccctggtgaaccacttatttttatcgaagttgctcttatggaa
accgttgcacagacaattcaggaagttttgtgggacaatcctcccataccagagaaccaa
gcaacatgcgctttattttactcgatttcttcaactcagcctggcttagctgggataaac
ctcgggaaatttctgatcaaacgagtgatcacattggtgaaaaaagacatgccacatgtt
tctacatttgcaacacttagccccattcctggattcatgcaatggctcctctcaaaatta
tcgtctcagtcaagatttgctgaagatgagcgtagtacacagagcaattcgccatcatct
acttttagcgagaaagtattactaccagaagaggaacaagccctcatgagtctatcagat
gattctccatccggtagcaatggcatggaagtgctattgaatttgctatcagtaaagaac
tgcgattgggctacttctcctcgcctattgccagttttagaacctattcttatgcggtta
tgtgctaggtacctcttgcaagagaagaaaagaggaaaagctttagactctgttgctaac
ttccacttgcaaaatggagcgatggttgaaagaataaattggatggcggatcgatcagag
aaaggtattcatcaaagtggaggcatcatggttaactatgtctataggttagagaatatc
gaagactatgctcaatcgtattttgggtcgggcaaaattcatgcctctcccggtatccat
tcccgtctctaa

DBGET integrated database retrieval system