KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_490158Help
Entry
ARALYDRAFT_490158 CDS       T01578                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:aly00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 393 aa AA seqDB search
MYILDTGARFSAVRFSPSPTPLSRRYFIVRTNLPFPKHQAKYHKELEVAIDAVDRACRLC
VDVKRSLFSSKEKIVEKNDQTPVTIADFGVQALVSLELSKVFPSIPLVAEEDSHFVRANN
LVSSVVSEVKSKASIGDNELSDADVLEAIDRGGKGAYAFCNKPATYWVLDPIDGTRGFLK
GDDALYVVGLALVVDNEIVLGVMGCPNWPEEISDGSTGTLMLSHIGCGTWTKRLQNVSGK
VTGDWTRCFVDACVLMNKARFCIQESQTWESLPLSGFFDASIVSEDLQHKEILLLPTCCG
SLCKYLMVASGRASVFLLRAKTQRTIKSWDHAVGIICVHEAGGKVTDWEGDEINLEEDQS
ERRLIFPAGGVVVSNGSLHNQIIEMITSASPTF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtacattctcgacaccggagctcgattctccgccgtcagattctcaccttctcctaca
cctctcagcagacgatacttcatcgtaagaactaatcttccgtttccgaagcatcaagct
aagtatcataaagagcttgaggtcgccattgatgctgttgatagagcttgtcgtctctgt
gttgatgtcaaaagatcgcttttttcttctaaagagaagattgttgagaagaatgatcaa
actccagttacaattgcagattttggagttcaagctttagtcagcttggagctttcgaaa
gtgtttccttcaatacctttggtggctgaggaagactctcattttgtgcgtgctaataac
cttgtaagctctgtggtaagtgaagtcaaatcaaaagcaagcattggagacaatgagttg
tctgatgctgatgtactagaagcaattgacagaggtggaaaaggtgcttacgctttttgc
aacaaaccagctacttattgggttttggatccaattgatggcacaagagggtttcttaaa
ggagatgacgctttatatgtggtaggattggcccttgttgtagataatgaaattgtgcta
ggagtcatgggctgtccaaactggccagaagaaatttcagatggatccaccggaacccta
atgctgtcgcatataggctgtggaacgtggaccaagaggttacaaaatgtctctggcaaa
gtaaccggtgactggacaaggtgttttgttgatgcctgtgttttaatgaacaaagcaagg
ttttgtatacaagaaagccaaacctgggaatcacttcctctctctggtttcttcgacgca
agtatagtttcagaggacttacaacataaagagattcttcttttgcccacatgttgtgga
agtttgtgcaagtatttgatggtagcttctggcagagcatcagttttccttctccgagcc
aaaactcagcgaacgataaagtcgtgggatcatgctgttgggatcatatgtgttcatgaa
gccggaggaaaggtaacagattgggaaggagatgagatcaatttggaggaagatcaatca
gaaaggaggctcatttttcccgcgggtggtgttgtagtaagcaacggaagtctacataat
cagattattgagatgatcacttctgcttcaccaactttttga

DBGET integrated database retrieval system