KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_490617Help
Entry
ARALYDRAFT_490617 CDS       T01578                                 

Definition
ATPLC1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ARALYDRAFT_490617
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    ARALYDRAFT_490617
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     ARALYDRAFT_490617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 575 aa AA seqDB search
MSESFKVCFCCSRSFKEKTREPPVSIKRLFEAYSRNGKMSFDELLRFVSEVQGERHAGLD
YVQDIFHSVKHHNIFHHHGLVHLNAFYRYLFSDTNSPLPMSGQVHHDMKAPLSHYFVYTG
HNSYLTGNQVNSRSSVEPIVQALRKGVKVIELDLWPNPSGNAAEVRHGRTLTSHEDLQKC
LNAIKDNAFYVSDYPVMITLEDHLPPNLQAQVARMLTKTFRGMLFRCGSESWKHFPSPEE
LKKKILISTKPPKEYLESKTVQTTRTPMVKETSWSRVASSTNMARGGENKILEEKGELES
EAVGGYRDLIAIHAANCKDPLKDCLSDDPEKPRRVSMDEQWLETMVRTRGTDLVRFTQRN
LVRIYPKGTRVDSSNYDPHVGWTHGAQMVAFNMQGHGKQLWIMQGMFRANGGCGYVKKPR
ILLDEHTLFDPCKRLPIKTTLKVKVYTGEGWDLDFHQTHFDQYSPPDFFVKIGIAGVPRD
TVSYRTETAVDQWFPIWSNDEFLFQLCVPELALLWFKVQDYDNDTQNDFAGQTCLPLPEL
KSGVRAVRLHDRAGKAYKNTRLLVSFALDPPYTFR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagagtttcaaagtgtgcttctgttgtagcagaagcttcaaggagaaaacgagg
gaaccaccagtgagcatcaagagactcttcgaagcttactcaagaaacggcaagatgtct
ttcgatgagcttcttagatttgtgagtgaagttcaaggagagcggcacgcagggttggac
tacgtgcaggatatcttccacagcgttaaacaccacaacatttttcatcaccatggactt
gttcatctcaacgccttctatcggtacctcttcagcgataccaactctcctcttcccatg
tctggccaggtgcatcatgacatgaaggcgccgttatcgcattactttgtctacacggga
cacaactcttacttgactgggaaccaagtgaacagcagaagcagcgtagaaccgatcgtg
caggctctcagaaaaggcgtaaaggtgatcgagctcgacttatggcctaatccttcaggg
aacgctgctgaagttcgtcatggcaggacacttacatcgcatgaagatctgcagaaatgt
ctgaacgccatcaaggataacgcgttttacgtgtctgactatccagtcatgatcactctc
gaagatcatttgccacccaatcttcaagcgcaagttgctaggatgttaactaaaacattc
agagggatgctgtttcgttgtggctcagagagttggaagcattttccatcaccagaagaa
cttaagaagaagattctcatctctacgaagcctccaaaggagtatcttgagagcaaaact
gtacagacaacaagaactccaatggttaaagagacttcgtggagcagagtagcgagtagt
actaatatggcacggggaggagaaaacaagattcttgaagaaaaaggagaattggagagt
gaagctgtaggaggatatagagacttgatcgcaatccacgctgcaaactgcaaagatcct
ttgaaggattgcttgagtgatgatccagagaagcctcgaagggttagcatggacgagcag
tggctagagacaatggttaggaccagaggaacggatcttgtcaggtttacacagaggaat
ctggtgaggatatatccaaagggtacaagagtggactcgtcaaactacgatccccatgtt
ggttggacacacggtgctcaaatggttgcttttaacatgcaaggacatgggaagcaacta
tggataatgcaaggaatgttcagggcgaatggtggatgtgggtacgttaaaaagcctcgc
atcttgctagacgagcacacactcttcgacccttgcaaaaggcttcccatcaagaccact
ctcaaggtgaaggtttacacaggggaaggatgggatttggatttccatcagacacacttt
gatcaatactctcctccagatttcttcgtaaagattggaatagcaggagttccgagagac
acggtctcatacagaacggaaacagctgtcgatcagtggtttcctatatggagcaacgac
gagttcctgtttcagctgtgtgttccagaactggcgcttctgtggttcaaggtccaagac
tacgacaatgacacccagaatgatttcgcaggacagacatgtcttcctctgccggaactg
aagtccggagtcagagccgtccggcttcacgatcgagcaggcaaggcttacaaaaacacg
aggcttctcgtcagcttcgccttggatcctccttatacgtttcgttga

DBGET integrated database retrieval system