KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_491774Help
Entry
ARALYDRAFT_491774 CDS       T01578                                 

Gene name
MTO2
Definition
(RefSeq) methionine over-accumulator
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00260  Glycine, serine and threonine metabolism
aly00750  Vitamin B6 metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01230  Biosynthesis of amino acids
Module
aly_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_491774 (MTO2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ARALYDRAFT_491774 (MTO2)
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ARALYDRAFT_491774 (MTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP OKR_DC_1_N
Motif
Other DBs
NCBI-GeneID: 9303457
NCBI-ProteinID: XP_002867385
UniProt: D7MCH0
Position
Unknown
AA seq 526 aa AA seqDB search
MASSCLFNASVSSLNPKQDPIRRHRSASLLRHRPVFVSCTADGNNNKAPIETAVKPPHRT
EDNIRDEARRNRSTAVNPFSAKYVPFNAAPGSTESYSLDEIVYRSRSGGLLDVEHDMEAL
KRFDGAYWRDLFDSRVGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFG
KQFLGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMKRPVVGVGCASTGDTSAALS
AYCASAGIPSIVFLPANKISMAQLVQPIANGAFVLSIDTDFDGCMKLIREITAELPIYLA
NSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCHELGLVDRIP
RMVCAQAANANPLFLHYKSGWKDFKPMTASTTFASAIQIGDPVSIDRAVYALKKCNGIVE
EATEEELMDAMAQADSTGMFICPHTGVALTALFKLRNQGVIAPTDRTVVVSTAHGLKFTQ
SKIDYHSNAIPDMACRFSNPPVDVKADFGAVMDVLKSYLGSNTLTS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcttgtctcttcaacgcctctgtatcttccttaaaccctaaacaagacccc
atccgccgccaccgctcagcctctctcctccgccaccgtcccgtcttcgtctcctgtacc
gccgatggcaacaacaacaaagctccgatcgagacagctgtcaagcctcctcaccgtacc
gaggataacattcgagatgaggctcgtcgcaaccgttccaccgccgtgaatccattttca
gctaaatacgttccgttcaatgcagctcctggatccactgagtcttactctctcgacgag
atcgtgtaccgtagccgctccggtggtttgcttgatgtcgagcacgatatggaggctttg
aagcgattcgatggcgcgtattggcgagatctctttgattcgcgtgttggtaaaagcaca
tggccttatggatcgggtgtttggtcgaagaaagagtgggttcttcctgagatcgatgac
gacgacatcgtttcggcttttgaaggaaactcgaatctgttttgggctgagagatttggt
aaacagtttctaggaatgaatgatctgtgggtgaaacactgtgggattagtcatacagga
agtttcaaggatcttggaatgactgttttggttagtcaagttaatcgcctgaggaagatg
aaacgacctgtggttggtgttggatgtgcttccaccggagatacctctgctgctctgtct
gcttattgtgcctccgctggaatcccatcgattgtgttcttaccggcgaacaagatctca
atggctcagctggttcagccgatagctaatggtgcgtttgttttgagtattgacactgat
tttgatgggtgtatgaagctgattagagagataactgcggaattgccgatttatttggcg
aattcgttgaatagtttgaggttagaagggcagaaaactgcagctattgagattttgcag
cagtttgattggcaagttccggattgggtgattgttcctggaggcaatctcggaaacatt
tatgccttttacaaaggattcaagatgtgtcacgaactgggacttgtcgataggatccct
aggatggtctgtgcacaagcggctaatgctaatcctcttttcttgcactacaagtctggt
tggaaggacttcaagcccatgactgcaagcaccaccttcgcctctgcgattcagatcggt
gaccctgtctccatcgatagagctgtgtacgctctcaagaagtgcaacggtattgtagaa
gaagccactgaggaggagctgatggatgcaatggctcaagccgattcgactggaatgttt
atctgtcctcatacaggtgtagctctaactgctctgttcaagctgaggaaccaaggagtg
attgcaccgactgatcgaactgtggttgtgagtactgctcatgggttgaagtttactcaa
tctaagatagattatcactccaatgccatccctgacatggcttgcagattctccaatcct
cctgttgatgtgaaagcagattttggagctgtcatggatgttctcaagagttacttagga
agtaatacacttacgtcataa

DBGET integrated database retrieval system