KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_491774Help
Entry
ARALYDRAFT_491774 CDS       T01578                                 

Gene name
MTO2
Definition
methionine over-accumulator
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aly01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aly00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:aly00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 526 aa AA seqDB search
MASSCLFNASVSSLNPKQDPIRRHRSASLLRHRPVFVSCTADGNNNKAPIETAVKPPHRT
EDNIRDEARRNRSTAVNPFSAKYVPFNAAPGSTESYSLDEIVYRSRSGGLLDVEHDMEAL
KRFDGAYWRDLFDSRVGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFG
KQFLGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMKRPVVGVGCASTGDTSAALS
AYCASAGIPSIVFLPANKISMAQLVQPIANGAFVLSIDTDFDGCMKLIREITAELPIYLA
NSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCHELGLVDRIP
RMVCAQAANANPLFLHYKSGWKDFKPMTASTTFASAIQIGDPVSIDRAVYALKKCNGIVE
EATEEELMDAMAQADSTGMFICPHTGVALTALFKLRNQGVIAPTDRTVVVSTAHGLKFTQ
SKIDYHSNAIPDMACRFSNPPVDVKADFGAVMDVLKSYLGSNTLTS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcttgtctcttcaacgcctctgtatcttccttaaaccctaaacaagacccc
atccgccgccaccgctcagcctctctcctccgccaccgtcccgtcttcgtctcctgtacc
gccgatggcaacaacaacaaagctccgatcgagacagctgtcaagcctcctcaccgtacc
gaggataacattcgagatgaggctcgtcgcaaccgttccaccgccgtgaatccattttca
gctaaatacgttccgttcaatgcagctcctggatccactgagtcttactctctcgacgag
atcgtgtaccgtagccgctccggtggtttgcttgatgtcgagcacgatatggaggctttg
aagcgattcgatggcgcgtattggcgagatctctttgattcgcgtgttggtaaaagcaca
tggccttatggatcgggtgtttggtcgaagaaagagtgggttcttcctgagatcgatgac
gacgacatcgtttcggcttttgaaggaaactcgaatctgttttgggctgagagatttggt
aaacagtttctaggaatgaatgatctgtgggtgaaacactgtgggattagtcatacagga
agtttcaaggatcttggaatgactgttttggttagtcaagttaatcgcctgaggaagatg
aaacgacctgtggttggtgttggatgtgcttccaccggagatacctctgctgctctgtct
gcttattgtgcctccgctggaatcccatcgattgtgttcttaccggcgaacaagatctca
atggctcagctggttcagccgatagctaatggtgcgtttgttttgagtattgacactgat
tttgatgggtgtatgaagctgattagagagataactgcggaattgccgatttatttggcg
aattcgttgaatagtttgaggttagaagggcagaaaactgcagctattgagattttgcag
cagtttgattggcaagttccggattgggtgattgttcctggaggcaatctcggaaacatt
tatgccttttacaaaggattcaagatgtgtcacgaactgggacttgtcgataggatccct
aggatggtctgtgcacaagcggctaatgctaatcctcttttcttgcactacaagtctggt
tggaaggacttcaagcccatgactgcaagcaccaccttcgcctctgcgattcagatcggt
gaccctgtctccatcgatagagctgtgtacgctctcaagaagtgcaacggtattgtagaa
gaagccactgaggaggagctgatggatgcaatggctcaagccgattcgactggaatgttt
atctgtcctcatacaggtgtagctctaactgctctgttcaagctgaggaaccaaggagtg
attgcaccgactgatcgaactgtggttgtgagtactgctcatgggttgaagtttactcaa
tctaagatagattatcactccaatgccatccctgacatggcttgcagattctccaatcct
cctgttgatgtgaaagcagattttggagctgtcatggatgttctcaagagttacttagga
agtaatacacttacgtcataa

DBGET integrated database retrieval system