KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_491777Help
Entry
ARALYDRAFT_491777 CDS       T01578                                 

Definition
ATMKK2
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:aly04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 372 aa AA seqDB search
MKKGGFSNNLKLAIPVAGEQSITKFLRKCFCSLCRTQSGTFKDGDLRVNKDGVRIISQSE
PEVLSPIKPADDQLSLSDLDMVKVIGKGSSGVVQLVQHKWTGQFFALKVIQLNIDEAIRK
AIAQELKINQSSQCPNLVTSYQSFYDNGAISLILEYMDGGSLADFLKSVKTIPDSYLSAI
FRQVLQGLIYLHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVMTNTAGLANTFVGTY
NYMSPERIIGNKYSNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQTP
PALPSGNFSPELSSFISTCLQKDPNSRSSAKELMEHPFLNKYDYSGINLASYFTDAGSPL
ATLGNLSGTFSV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggtggatttagcaataatctgaagctcgcaattcctgttgctggcgagcaa
tccatcaccaaattcctgcggaaatgtttttgttctctctgtaggacgcagagcggtacg
tttaaggatggagatctacgagttaacaaagatggagttcgaatcatctctcaatcggag
cctgaagtcctgtctccaattaagccagctgatgatcagctgagcttgtcggatttggat
atggttaaagtcattggcaaaggaagcagtggtgttgttcagttggttcaacacaaatgg
actggccaatttttcgccttgaaggtcattcaactaaatattgatgaagcaattcgcaag
gcaattgcacaagagctcaaaataaatcaatcctcacagtgtccaaatcttgttacctcg
taccagtcattttatgacaatggtgcaatctcactaatcttggagtacatggatggagga
tctctagcagactttctcaaatcagttaaaaccatccctgactcctatctttctgccatc
tttagacaagtgcttcaaggattgatctatcttcatcacgataggcatatcatccaccgt
gacttgaaaccatccaatctgttgatcaaccacagaggagaagtcaaaataactgacttt
ggtgtgagtaccgttatgacaaacaccgcaggtttagcaaacacatttgtggggacttac
aattatatgtctccagagcgaatcattggaaacaagtacagtaacaaaagtgatatatgg
agcttgggtttagtagtactcgaatgtgcaacaggaaagttcccttatgcacctccgaat
caagaggaaacatggaccagtgttttcgagttgatggaagccattgttgaccaaacgcca
cccgctcttccttcgggaaatttctcccctgagttatcttcattcatctccacatgtttg
caaaaggatccaaacagtcgaagctctgcaaaggaactaatggaacatcctttcttgaac
aaatacgactactcggggatcaatctcgcgtcctacttcacagatgcaggatcgccactt
gcaacacttgggaatctgtccggtacgttctcggtttaa

DBGET integrated database retrieval system