KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_491857Help
Entry
ARALYDRAFT_491857 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ARALYDRAFT_491857
  Lipid metabolism
   00071 Fatty acid degradation
    ARALYDRAFT_491857
   00592 alpha-Linolenic acid metabolism
    ARALYDRAFT_491857
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ARALYDRAFT_491857
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     ARALYDRAFT_491857
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ARALYDRAFT_491857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 721 aa AA seqDB search
MAKKIGVTMDVGNDGVAVITISNPPVNSLASPIISGLKEKFRDANQRNDVKAIVLTGNNG
RFSGGFDINVFQQVHKTGDLSLMPEVSVELVCNLMEDSRKPLVAAVEGLALGGGLELAMA
CHARVAAPKAQLGLPELTLGVIPGFGGTQRLPRLVGLAKATDMILLSKSISSEEGQKLGL
IDALVPPGDVLSTSRKWALDIADGRKPFLRSLHRTDKIGSLSEARAILKNSRQLAKKVAP
NMPQHHACIEVIEEGIVHGGYSGVLKEAEVFKQLVLSDTAKGLVHVFFAQRATSKVPNVT
DVGLKPRPIKKVAVIGGGLMGSGITTALLLSNIRVVLKEINSEYLMKGTKSVEANIKGLV
SRGKLTQDKAGKALSLFKGVLDYTEFKDVDMVIEAVIENIQLKQNIFKEIEKVCSPHCIL
ASNTSTIDLDVIGEKTNSKDRIVGAHFFSPAHLMTLLEIVRSKNTSAQVILDLMAVGKAI
KKVPVVVGNCIGFAVNRTFFPYTQAAHMLANLGVDLFRIDSVITSFGLPLGPFQLGDLAG
HGIGLAVGPIYAKVYGDRMFRSPMTELLLKSGRNGKINGKGYYIYEKGSKPKPDPSVLSI
VEESRKLTNIMPGGKPISVSDKEIVEMILFPVVNEACRVLDEGVVIRASDLDIASVLGMS
FPSYRGGIVFWADTVGPKYIYERLKRLSETYGSFFKPSRYLEERAMNGMLLSESKSSRSR
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagattggagtgacgatggatgttgggaacgatggtgttgctgtcatcacc
atttctaatcctcctgttaactctttggccagtccaattatttctgggttgaaggagaag
tttcgagacgccaatcaaaggaatgatgttaaggccatcgtattgactgggaacaatgga
agattttcgggtggtttcgatatcaatgtcttccagcaagttcataagactggggattta
tcgcttatgcctgaagtatctgttgagcttgtgtgtaacctgatggaagactctaggaag
ccgcttgttgctgcagttgaaggattagctcttggtggtggtttggaactcgcaatggcg
tgtcatgcccgtgttgctgctccgaaagctcaactaggcttaccagaattgactcttgga
gtgattccaggttttggaggaacccaacgtcttccaaggctagtaggccttgcaaaagca
acggatatgatactgctttcgaagtcaatatcgtcagaagaggggcaaaaactgggtctt
attgatgccttggtgccacctggagatgtgttgagcacgtccagaaagtgggctctagat
attgcagatggacgtaaaccctttttgcgctcactgcacaggaccgacaaaattggttct
ttatctgaagctcgtgctatattaaagaattcaagacagctagccaagaaggtagcccca
aatatgcctcagcaccatgcttgcattgaggtgattgaagaaggaatcgtccatggagga
tatagtggggttcttaaggaagcagaagttttcaagcaactagtactgtcagacactgca
aagggtcttgttcatgttttcttcgcacaacgtgcaacatcaaaagtgcctaatgtaact
gacgttggattgaaaccgaggccgataaaaaaagttgcagttattggtggaggtctgatg
ggttctggcatcactacggctctacttctaagcaatataagagttgtgcttaaagaaata
aattcagaataccttatgaagggaacaaaatcagttgaagcaaatatcaaaggcttggta
tctagggggaaactgacacaagataaagcaggaaaggccctctctttgttcaagggagta
ctcgactacacagaattcaaagatgtggacatggtcatagaggcagtgattgaaaacatt
cagttgaaacaaaacatattcaaagaaatcgaaaaggtttgttcaccccattgcattttg
gcgagtaatacatctactatcgacctcgacgtaattggggaaaagactaactcaaaagat
cgcattgttggcgcacatttcttcagcccggcccatctgatgacccttctcgagattgtt
cgttcaaagaatacttctgctcaggtgattttggatctcatggcggttggaaaggccata
aagaaagttcccgtggtggttggaaactgcataggctttgcagtgaataggacattcttt
ccgtatacacaagctgcacatatgttggccaatctaggtgttgacttgttcagaattgac
agcgtgattacctctttcggcttgccgttgggccctttccagcttggtgatttggctgga
cacgggattggattagcagttgggccgatatatgccaaggtctatggtgaccgcatgttc
agatctccaatgaccgagcttcttcttaagagcgggcgaaatggaaaaatcaacgggaaa
ggatactatatatacgaaaagggaagcaaaccaaaacccgatccatcagtgctttcaatt
gttgaggaatcgaggaaactgaccaatataatgcctggtgggaagcctatatcagtatct
gacaaagaaattgtagagatgatcttattccctgtggttaacgaggcatgccgtgtccta
gatgaaggagttgtgatccgagcctcagacttggacattgcgtcagtccttggaatgagt
tttccttcttaccgtgggggaattgttttctgggcagacacagttggaccaaagtacata
tatgaaaggctcaagagattgtcggagacttacggcagctttttcaaaccgtcgaggtat
ctggaggaaagagcaatgaatggaatgcttttgagtgaatcgaaatcgtcgaggtctcga
ttgtga

DBGET integrated database retrieval system