KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_492090Help
Entry
ARALYDRAFT_492090 CDS       T01578                                 

Gene name
TSB2
Definition
tryptophan synthase beta-subunit
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ARALYDRAFT_492090 (TSB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_492090 (TSB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARALYDRAFT_492090 (TSB2)
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ARALYDRAFT_492090 (TSB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 471 aa AA seqDB search
MATAGTAATFRPSVSASSKATRLRSPSKRPKFTPLPSSRSRSSSSFSVSCTIAKDPTVFM
ADTEAAGSDPTMWQRPDSFGRFGKFGGKYVPETLMHALSELETAFYSLATDEDFQRELAE
ILKDYVGRESPLYFAERLTEHYRRENGEGPLIYLKREDLNHTGAHKINNAVAQALLAKRL
GKKRIIAETGAGQHGVATATVCARFGLQCIIYMGAQDMERQALNVFRMRLLGAEVRGVHS
GTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGKETRRQAMEKWG
GKPDVLVACVGGGSNAMGLFHEFVDDAEVRMIGVEAAGFGLDSGKHAATLTKGDVGVLHG
AMSYLLQDDDGQIIEPHSISAGLDYPGVGPEHSFLKDMGRAEYYSVTDEEALEAFKRVSR
LEGIIPALETSHALAHLEKLCPTLSDGTRVVLNFSGRGDKDVQTAIKYLEV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcaggcaccgctgctactttcagaccctccgtttcagcttcttccaaagca
acccgtctgagatcgccctccaaacgccccaaatttacgcctctgccatcgtctcgctca
cggtcctcttcttctttttccgtctcttgcaccatcgctaaggacccgactgttttcatg
gcggatacggaggccgctggatctgatccgaccatgtggcaacgacccgattcattcggt
cggttcgggaagtttggcgggaagtatgtccccgaaactctaatgcacgccctctctgaa
ctcgaaacggctttctattcgctcgccaccgacgaagatttccagagagaattggcagag
atcttgaaagactatgtgggtcgggaaagtcctctttactttgcagagaggctcacagag
cattaccgccgagaaaacggggaaggaccgctcatatacctcaaaagggaagacttgaac
cacaccggtgctcacaagatcaacaacgctgtggctcaggctcttctcgccaagcgtcta
ggaaagaaacggattattgctgagacaggggctggtcaacatggcgtagccacagctaca
gtgtgtgcacgtttcgggttgcagtgcattatctacatgggtgctcaagacatggagaga
caagctcttaatgtgttcaggatgcgtcttctcggtgctgaggtaaggggagtccactct
ggaacagccactttaaaggacgcaacttctgaagctataagggattgggtgacaaatgtg
gagactacacattacatattgggatccgttgcgggtcctcatccttaccctatgatggtc
agggactttcatgccgtgattggtaaagaaacaaggagacaagctatggagaaatggggc
gggaagcctgatgttctggttgcttgtgtcggtggtggttcaaatgccatgggactcttc
catgaatttgtcgatgacgcagaggttcggatgattggtgtggaagccgctggatttgga
ttggacagcggcaaacacgctgccacattgacaaaaggagatgtcggtgtactccatgga
gctatgagttacttgctgcaagatgatgatggccaaatcattgaaccacactccatcagt
gccggattggattaccctggagtcggacctgagcatagtttccttaaagacatgggacgg
gctgagtactatagcgttaccgatgaagaagccttagaagctttcaagagagtgtctcgg
ttggagggaataatcccggcactagagacatcgcacgcgttggcccatctagagaagctt
tgtccgacgttatctgatggaaccagagtggtcttaaacttcagtgggagaggcgacaag
gatgttcagactgcaatcaagtatctcgaagtttaa

DBGET integrated database retrieval system