KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_492108Help
Entry
ARALYDRAFT_492108 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00020  Citrate cycle (TCA cycle)
aly00310  Lysine degradation
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARALYDRAFT_492108
  Amino acid metabolism
   00310 Lysine degradation
    ARALYDRAFT_492108
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ARALYDRAFT_492108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H RnfC_N DUF3729
Motif
Other DBs
NCBI-GeneID: 9305659
NCBI-ProteinID: XP_002867535
UniProt: D7MEL2
Position
Unknown
AA seq 464 aa AA seqDB search
MMLRAVIRRATTKGSSPSLFGKSLQSSRVAASSPSLLTGSETGAFLHCGNHARSFHNLAL
PAGNSGISRSASLVSSTLQRWVRPFSSESGDTVEAVVPHMGESITDGTLATFLKKPGERV
QADEAIAQIETDKVTIDIASPASGVIQEFLVKEGDTVEPGTKVAIISKSEDAASQATPSQ
KIPETTDSKPSPPAEDKQKPKVESAPVAEKPKAPSSPPPPKQSAKEPQLPPKERERRVPM
TRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFYEKHGVKLGLMSGFIKA
AVSALQHQPVVNAVIDGDDIIYRDYVDISIAVGTSKGLVVPVIRGADKMNFAEIEKTINT
LARKANEGTISIDEMAGGSFTVSNGGVYGSLISTPIINPPQSAILGMHSIVSRPMVVGGS
VVPRPMMYVALTYDHRLIDGREAVYFLRRVKDVVEDPQRLLLDI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgcgtgctgttatcaggagagctaccactaaaggctcttctccttcgctattc
ggaaaatcactgcaatcttctcgtgttgctgcatcttccccaagcttgctaacaggttca
gaaacaggggcatttctgcattgtggaaatcatgctcgtagctttcataaccttgctttg
ccagcagggaactcgggcatctcgagatcagcgagtttagtttcctctaccctgcaaaga
tgggtcaggcctttttcatctgaaagtggagatactgtggaagctgttgtgcctcatatg
ggggaatcaatcactgatggcaccttagccacctttctgaagaaacctggtgagagagtc
caggctgatgaggctattgcacaaattgaaactgataaggtgacaatagatattgctagc
ccagcaagtggtgtaatccaagagtttctagtcaaggaaggagatactgtagaaccagga
accaaggtcgctattatatcaaagtctgaggatgctgcatctcaggctaccccctcccag
aagataccagagacaactgattccaaaccttctcctcctgctgaagataagcagaagcct
aaagtggaaagtgctcctgtagcagagaaacccaaggcaccatcctcaccacctccaccc
aaacagtctgctaaagaaccgcagcttcctcctaaagaaagagaaagacgggttcctatg
acaagacttcgtaaacgggttgcaacaagattgaaagactctcaaaatactttcgcattg
ctgacaactttcaatgaagttgatatgacaaatttgatgaagctccggtcccaatacaag
gatgcgttttatgaaaaacatggagtgaagttggggcttatgtctggattcattaaagct
gctgttagtgccctccagcatcaaccagttgtaaatgcagttatcgatggggatgatatc
atatacagagactatgtggatatcagtatcgctgttggtacctctaagggacttgtagta
ccagtcataagaggtgctgataaaatgaactttgccgagatagagaagacgataaacaca
cttgcgaggaaggcaaatgaaggaaccatatccatagatgagatggctggaggatcattc
accgtttcaaatggcggtgtctatggaagtctcataagcactccgatcattaaccctcct
cagtctgctatactcggtatgcactcgattgtgtcgcgtccaatggttgtaggaggaagc
gtagtgccaagaccaatgatgtacgtcgcacttacgtatgatcacaggctgattgatggt
agagaggctgtctacttcctgcgccgtgtcaaggatgttgtggaggatccacaaaggctt
cttcttgacatataa

DBGET integrated database retrieval system