KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_492391Help
Entry
ARALYDRAFT_492391 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     ARALYDRAFT_492391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 692 aa AA seqDB search
MTSALYASDLFKQLKSIIGTDSISDDVVLVIATTSLALVAGFVVLLWRKTTADRSQELKP
LMIPKSLMAKDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYEKAAVKVID
LDDYAADDDQYEEKLKKETLAFFCVATYGDGEPTDNAARFYKWFTEENEREIRLQQLAYG
VFALGNRQYEHFNKIGIVLDEELCKKGAKRLIQVGLGDDDQSIEDDFNAWKDSLWSELDK
LLKDEDDKSVATPYTAVIPEYRLVIHDPSFTTEKSRDLNVANGNTAIDIHHPCRVDVAVQ
KELHTHESDRSCIHLEFDISRTGITYETGDHVGVYAENHVEIVEEAGKLLGHSLDLVFSI
HADKEDGSPLGSAVPPPFPGPCTLGTGLARYADLLNPPRKSALVALAAYATEPSEATKLK
HLTSPDGKDEYSQWIVASQRSLLEVMAAFPSAKPPLGVFFAAIAPRLQPRYYSISSSPRL
APSRVHVTSALVYGPTPTGRIHKGVCSTWMKNAVPAEKSHECSGAPIFIRASNFKLPSNP
STPIVMVGPGTGLAPFRGFLQERMALKEDGEELGSSLLFFGCRNRRMDFIYEDELNNFVD
QGVISELIVAFSREGAQKEYVQHKMMEKAAQVWNLIKEEGYLYVCGDAKGMARDVHRTLH
TIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgctttgtatgcttccgatttgtttaagcagctcaagtcaattatagggacc
gattcgatatcggacgatgttgtacttgtgattgcaaccacgtctttggcactagtagct
ggctttgtggtgttgttatggaggaaaacgacggcggatcggagccaggagctgaagcct
ttgatgatccctaagtctcttatggctaaagacgaggacgatgatttggatttgggatcc
gggaagaccagagtctctatcttctttggtacgcagactggaacagctgagggatttgct
aaggcattatcagaagaaatcaaagcgagatatgaaaaagcagcagtcaaagtcattgac
ttggatgactatgctgccgatgatgaccaatatgaagagaaactgaagaaggaaactttg
gcattcttttgtgttgctacttatggagatggagagcctactgacaatgctgccagattt
tacaaatggtttacggaggaaaatgaacgggagataaggcttcaacaactagcatatggt
gtgtttgctcttggtaatcgccaatatgaacattttaataagatcgggatagttcttgat
gaagagctttgtaagaaaggtgcaaagcgtcttattcaagtcggtctaggagatgatgat
cagagcattgaggatgattttaatgcctggaaagattcgctatggtctgagctagacaag
ctcctcaaagacgaggatgataaaagtgtggcaactccttatacagctgttattcctgaa
taccggctggtgattcatgatcctagttttacaactgaaaaatcaagggacttaaatgtg
gccaacggaaatactgctattgacattcatcatccctgcagagttgatgttgctgtgcag
aaggagcttcacacacatgaatctgatcggtcttgcattcatctcgagttcgacatatcc
aggacgggtattacatatgaaacaggtgaccatgtaggtgtatatgctgaaaatcatgtt
gaaatagttgaagaagctggaaaattgcttggccactctctagatttagtattttccata
catgctgacaaggaagatggctccccattgggaagcgcagtgccgcctccattccctggt
ccatgcacacttgggactggtttggcaagatacgcagaccttttgaaccctcctcgaaag
tctgcgttagttgctttggcggcgtatgccactgaaccaagtgaagccacaaaacttaaa
catctgacatcacctgatggaaaggatgaatactcacagtggattgttgcaagtcagaga
agtcttttagaggtgatggctgcttttccatctgcaaaacccccactaggtgtatttttt
gctgcaatagctcctcgtctacaacctcgctactactccatctcatcctcgccaagattg
gcgccaagtagagttcatgttacatccgcactagtatatggtccaactcctaccggtaga
atccacaagggtgtgtgttcgacgtggatgaagaatgcagttcctgcggagaaaagtcat
gaatgtagtggagccccaatctttattcgagcatctaatttcaaattaccatccaaccct
tcaactccaatcgttatggtgggacctgggactggcctagcaccttttagagggtttctg
caggaaaggatggcactaaaagaagatggagaagaactaggttcatctttgctattcttt
gggtgtagaaatcgacggatggattttatatacgaggatgaactcaataattttgtggat
caaggcgtgatatctgagctcatcgttgcattctcccgtgaaggagcgcagaaggagtat
gttcaacataagatgatggagaaggcagcacaagtttggaatctaataaaggaagaagga
tatctctatgtatgtggtgatgctaagggcatggcgagggatgtccaccgaactctacat
accattgttcaggagcaggaaggtgtgagttcgtcagaggcagaggctatagttaagaaa
cttcaaactgaaggaagatacctcagagatgtctggtga

DBGET integrated database retrieval system