KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_492730Help
Entry
ARALYDRAFT_492730 CDS       T01578                                 

Definition
D-erythro-sphingosine kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ARALYDRAFT_492730
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     ARALYDRAFT_492730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1273 aa AA seqDB search
MKLLPLCPLQLSTTQTPTAIPMSLSFYKNELSEDTPCQSGYTDYISFQVPEETFPEIPNC
VGIAKGFKQNANNEKNGYTSLEAVLLSVPNGYTCVDLSLYKDKELVLLLNKTSADSEGSG
EACMMVVQTCDLPFISISRSSSLNQWEIEDLKVLLISVILIDGSIVNLEIENEKVRKVPH
SVIAPLAVSASRGVACVFAERRRALVYILEEDEDEEISDDKAFTHVGSATRQVKRVVVTF
PMIRQSRTKVSFGSKTKLSLSLYLSSSPSRRLSCLMENDQMISPTDIITGIVFIDGELAM
LTLTADGELRWTEYGLRQQLSMKKDVLGFVVQGKRIRVKVVVEKEAGICCGQFDGDFVRK
DFVFEPLIDQNGWCFKLRQYLDSLGRPKKLLVLVNPFGGKKLAREIFVKEVKPLFEDADV
QLEIQETKYQLHAKEIVKSMDVSKYDGIVCVSGDGVLVEVLNGLLERADWRTALKLPIGM
VPAGTGNGMIKSLLDTVGLRCCANSATISIIRGHKRFVDVATISQGNTKFFSVLMLAWGL
IADIDIESEKFRWMGSARIDFYVLVKLLALQRIICLRQYNGRILFLPAPGFESYGQPASC
SLYKEPPVSDKELGYQGPETKFEDLEWREIKGPFVTVWLHNVPWGAENTLTAPAAKFSDG
FLDLIVLKNCPKLVLLSLMRQTSSGTHVESPYITYLKVKAFVLEPGGLVDEPEKEGIIDS
DGEVLARGKRTYNCDQKALMSYDKLQVTVDQGNENQTNVLKIVVRVISDFILSFNSHQRR
NSSSSLLPMDRQPERENDELPSPVIISDRVLVNGVVTPLTLTADGELRSTESGRRKSTVA
KEILSFVVEGNKVRVKTLVERRGGICCGGSGGDYARNDFVFEPLSDESRKLWSDKLHQHL
DSLGRPKKLLVFVNPFGGKKSARKIFQEEVKPLFEDANIQLEIQETKYQLHAKEIVRSMD
VSKYDGIVCVSGDGILVEVVNGLLERADWKTALKLPIGMVPAGSGNGMIKSLLEPVGLPC
SATSATISIIRGRTRSLDVATISQGTTKFFSVLMLAWGLVADIDIESEKFRWMGGARFDI
YGLQRIICLRQYYGRILFVPAPGFESYGQRASCSVDKELSGSDKALVYQGPDTKLEDLDW
REMKGPFVSVWLHNVPWGAENTLAAPDAKFSDGFLDLIVMKDCPKLALLSLMTKLSDGTH
VQSPYVSYLKVKAFVLEPGARIDEPDKEGIIDSDGEVLARGRKSYKCDQKALMSYDKLQI
SVDQGLATLFSPE
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgttgccgctttgccctcttcagttgtcaacaacgcaaacacctacagcaatt
cccatgtctctttccttctataagaatgaactttctgaggatacaccttgtcaaagtggg
tacactgattacatatcttttcaagtccccgaagaaaccttcccagagattccgaactgt
gttggcatagctaagggttttaagcagaacgccaacaatgagaaaaatggttatacttct
ctggaagccgttttgttatctgtacctaatggctacacttgtgtcgatttgtctctctac
aaggataaagaactggttttattattgaataagacaagtgcagattccgaaggctcggga
gaagcatgcatgatggttgtacaaacttgtgaccttccattcatttccatttcaagatct
agttctctaaaccagtgggagatagaggatttgaaggtattactaatttcagtcattctc
atcgacggctcgattgttaacctggaaattgaaaatgaaaaagttcgcaaagttccacat
tctgtcattgctcctctagcagtaagcgcttcaagaggagtggcttgtgtttttgctgaa
agaagacgagctctggtgtacatattggaagaagatgaagacgaagaaatctctgatgac
aaagcgtttacgcacgtcggctcagccactcgccaggttaagcgcgtggttgtcactttc
cctatgatcagacaaagccgtacaaaagtcagctttggaagcaagacgaaactctctctc
tctctctatctaagttcgtcaccgtcacggaggttgtcttgtcttatggagaatgatcaa
atgatatctccgactgatataatcaccggcatagtgtttattgacggtgaattggctatg
ttgactttgactgccgacggggagttacggtggacagagtacggactccggcaacagttg
tcgatgaagaaggatgttcttggttttgttgtccaaggtaagcggattagagtaaaggtc
gtggttgagaaagaggcaggaatctgctgcggacaatttgatggagatttcgtgaggaaa
gatttcgtctttgagccactcatcgatcagaatggatggtgctttaagcttcgtcaatac
cttgattctctcggtcggccaaagaaattgcttgtattggtgaacccgtttggcgggaag
aaattggcgagagagatttttgttaaggaagtgaagcctttgtttgaagatgctgatgtt
caacttgagattcaagaaactaagtatcagttgcatgcaaaggagattgttaagtccatg
gatgtatcaaaatatgatggtattgtttgtgtcagcggcgatggtgtccttgttgaggtt
ctaaatggactactcgaaagagcagactggagaactgccttaaaattgccgatcggaatg
gtccctgcaggaactggtaatggcatgataaagtcattgttggacacggttgggcttcga
tgctgtgcaaatagtgctacgatttctattattcgaggtcataaacgttttgtagatgtt
gcaactatttcacaagggaataccaaattcttcagtgtcttgatgcttgcttggggttta
atagctgatatagacatcgagtcagagaagttccgatggatgggaagtgctcgcattgac
ttctatgtacttgttaaattgctggctcttcagaggataatatgtttaagacaatacaat
ggacgaatcttatttctaccggctcctgggttcgaaagctacggacagccagccagttgc
agtctatacaaagagccacctgttagcgataaagagctcgggtaccaaggacctgaaact
aaatttgaagatctagaatggagagaaatcaaaggtccatttgttactgtatggcttcac
aatgttccctggggtgctgagaacactttgactgctcctgctgcaaagttttctgatggc
tttctggacttgattgtattgaaaaactgccctaagcttgtcctgctctcgcttatgaga
cagacgagtagtggaacacatgttgagtcaccctatataacgtatctaaaggtgaaggca
tttgtactggagccgggtggacttgtagacgaaccagagaaggaaggaatcatagattca
gatggagaagttttggcaagaggaaaaagaacatataattgtgatcaaaaggctttgatg
tcttacgacaagcttcaagtaactgttgatcaaggaaatgagaaccaaacaaatgtttta
aagattgttgtgcgagttatttctgattttatcttgagcttcaactctcatcaacgacgg
aactcctcttcctccctcttgcctatggatcgtcagccggagagggagaatgatgaacta
ccgtctccggtgataatatccgaccgagttctggtaaatggtgttgtcacgccgttaact
ttgaccgccgacggagagctacgatcgacggaatctggacggcggaaatcgacggtggcg
aaagaaatcctgagttttgtcgtggaaggtaacaaggttagagtaaagactttggtggag
agacgaggaggaatttgctgtggaggaagtgggggagattatgcgaggaacgatttcgtt
ttcgagcctctctctgatgaatctagaaagctatggtccgataagctccatcaacacctc
gactctctcggtcggccaaagaaattgcttgtgtttgtgaacccatttggcgggaagaaa
tcagcgagaaagatttttcaagaggaagtgaagccattgtttgaagatgctaatattcaa
cttgagattcaagaaaccaagtatcagttgcatgcaaaggagattgttaggtctatggat
gtatcgaaatatgatggtattgtttgtgtaagcggcgacggcatccttgttgaggttgta
aatggactgcttgaaagagcagactggaaaactgccttaaagttgccaattggaatggtc
cctgcaggaagtggtaatggcatgattaaatcattgttggaaccggtagggcttccttgt
agtgcaacaagtgctacgatttcgataattcgaggtcgtacacgttctctagatgtagca
actatctcacaagggactaccaaattcttcagtgtcttgatgcttgcttggggtttagtg
gctgatatagacatcgagtcagagaagttcagatggatgggtggtgctcgctttgatatc
tatggtcttcagaggataatatgtttaagacaatactatggacgaattttatttgtgcca
gctcctgggtttgaaagctatgggcaacgagccagttgcagtgtagataaagagttatct
ggtagtgataaggcactcgtataccaaggacctgatactaaactcgaagatctggattgg
agagaaatgaaaggcccatttgtttcagtatggcttcataatgttccctggggtgctgag
aacactttggcagctcctgacgcaaagttttctgatggcttcctggatttgattgtcatg
aaagactgtcctaaacttgccttgctatcacttatgacaaagttgagtgatggaacacat
gttcaatcaccatatgtatcctatctaaaggtgaaggcattcgtgctggagccaggtgca
cgcatagatgaaccagacaaggaaggaatcattgattcagatggagaggttctggcaaga
ggaagaaaatcatacaaatgcgatcaaaaggctttgatgtcttatgacaagcttcagata
agtgttgatcaaggtttagccactctcttctctcctgaataa

DBGET integrated database retrieval system