KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_493066Help
Entry
ARALYDRAFT_493066 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  
translation initiation factor 4E
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARALYDRAFT_493066
Messenger RNA biogenesis [BR:aly03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     ARALYDRAFT_493066
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     ARALYDRAFT_493066
Translation factors [BR:aly03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ARALYDRAFT_493066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 235 aa AA seqDB search
MAVEDTPKSVVTEEANPNSIENPIDRYHEEGDDAEEGEIVGGDGDGNVDESSKSAVPQSH
PLEHSWTFWFDNPSVKSKQTTWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCF
KHNIEPKWEDPICANGGKWTMNFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGK
QERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIHEDAKKLDRNAKNAYTA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagaagacactcccaaatctgttgttacggaagaagcaaaccctaattctata
gagaatccgattgatcgataccatgaggaaggtgatgatgccgaagaaggagagatcgtt
ggaggtgatggagacggaaacgttgacgaatcgagcaaatccgctgttcctcaatcgcat
cctttagaacattcatggactttctggttcgataatccttctgtgaaatcgaagcaaacc
acttggggaagttccttgcgacccgtgttcacgttctccactgttgaggaattttggagt
ttgtacaataacatgaagcatccgagcaagttagctcatggagctgacttctactgtttc
aaacacaatattgaacctaagtgggaggatcctatttgtgcaaatggaggcaaatggact
atgaatttccctaaggagaagtctgataagagctggctctacactttgcttgctttgatt
ggagaacagttcgatcacggagatgaaatatgcggagcagttgttaacattagaggaaag
caagaaaggatatctatttggaccaaaaacgcttcaaacgaagctgctcaggtgagcatt
ggaaaacaatggaaggagtttcttgattacaacaacagcataggtttcatcatccatgag
gatgcgaagaagctcgacaggaatgcaaagaacgcttacaccgcttga

DBGET integrated database retrieval system